FOXD2 (forkhead box D2)

Gene

• Entrez ID: 2306
• Gene name: Forkhead box D2
• Gene symbol: FOXD2
• Synonyms (NCBI Gene): FKHL17, FREAC-9, FREAC9
• Chromosome: 1
• Chromosome location: 1p33
• Summary: This gene belongs to the forkhead family of transcription factors which is characterized by a distinct forkhead domain. The specific function of this gene has not yet been determined. [provided by RefSeq, Jul 2008]

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT018455	hsa-miR-335-5p	Microarray	18185580
MIRT029980	hsa-miR-26b-5p	Microarray	19088304
MIRT1001575	hsa-miR-3121-3p	CLIP-seq
MIRT1001576	hsa-miR-3150b-3p	CLIP-seq
MIRT1001577	hsa-miR-3929	CLIP-seq
MIRT1001578	hsa-miR-4419b	CLIP-seq
MIRT1001579	hsa-miR-4452	CLIP-seq
MIRT1001580	hsa-miR-4478	CLIP-seq
MIRT1001581	hsa-miR-4532	CLIP-seq
MIRT1001582	hsa-miR-4689	CLIP-seq
MIRT1001583	hsa-miR-4784	CLIP-seq
MIRT1001584	hsa-miR-485-5p	CLIP-seq
MIRT1001585	hsa-miR-516b	CLIP-seq
MIRT1996788	hsa-miR-1270	CLIP-seq
MIRT1996789	hsa-miR-3120-3p	CLIP-seq
MIRT1996790	hsa-miR-3153	CLIP-seq
MIRT1996791	hsa-miR-3189-3p	CLIP-seq
MIRT1996792	hsa-miR-3714	CLIP-seq
MIRT1996793	hsa-miR-432	CLIP-seq
MIRT1996794	hsa-miR-4434	CLIP-seq
MIRT1996795	hsa-miR-450b-3p	CLIP-seq
MIRT1996796	hsa-miR-4516	CLIP-seq
MIRT1996797	hsa-miR-4531	CLIP-seq
MIRT1996798	hsa-miR-4654	CLIP-seq
MIRT1996799	hsa-miR-4713-3p	CLIP-seq
MIRT1996800	hsa-miR-4769-5p	CLIP-seq
MIRT1996801	hsa-miR-4773	CLIP-seq
MIRT1996802	hsa-miR-502-5p	CLIP-seq
MIRT1996803	hsa-miR-545	CLIP-seq
MIRT1996804	hsa-miR-548an	CLIP-seq
MIRT1996805	hsa-miR-548p	CLIP-seq
MIRT1996806	hsa-miR-620	CLIP-seq
MIRT1996807	hsa-miR-638	CLIP-seq
MIRT1996808	hsa-miR-769-3p	CLIP-seq
MIRT2230738	hsa-miR-3692	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	ISA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IDA	12621056
GO:0003677	Function	DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0003700	Function	DNA-binding transcription factor activity	TAS	9403061
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005634	Component	Nucleus	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0009653	Process	Anatomical structure morphogenesis	IBA
GO:0030154	Process	Cell differentiation	IBA
GO:0043565	Function	Sequence-specific DNA binding	IDA	23332764
GO:0043565	Function	Sequence-specific DNA binding	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	12621056
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536

Other IDs

• MIM: 602211
• HGNC: 3803
• e!Ensembl: ENSG00000186564

Protein

• UniProt ID: O60548
• Protein name: Forkhead box protein D2 (Forkhead-related protein FKHL17) (Forkhead-related transcription factor 9) (FREAC-9)
• Protein function: Probable transcription factor involved in embryogenesis and somatogenesis.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00250	Forkhead	126 → 212	Forkhead domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Kidney specific. {ECO:0000269|PubMed:9403061}.
• Sequence:

  MTLGSCCCEIMSSESSPAALSEADADIDVVGGGSGGGELPARSGPRAPRDVLPHGHEPPA
  EEAEADLAEDEEESGGCSDGEPRALASRGAAAAAGSPGPGAAAARGAAGPGPGPPSGGAA
  TRSPLVKPPYSYIALITMAILQSPKKRLTLSEICEFISGRFPYYREKFPAWQNSIRHNLS
  LNDCFVKIPREPGNPGKGNYWTLDPESADMFDNGSFLRRRKRFKRQPLPPPHPHPHPHPE
  LLLRGGAAAAGDPGAFLPGFAAYGAYGYGYGLALPAYGAPPPGPAPHPHPHPHAFAFAAA
  AAAAPCQLSVPPGRAAAPPPGPPTASVFAGAGSAPAPAPASGSGPGPGPAGLPAFLGAEL
  GCAKAFYAASLSPPAAGTAAGLPTALLRQGLKTDAGGGAGGGGAGAGQRPSFSIDHIMGH
  GGGGAAPPGAGEGSPGPPFAAAAGPGGQAQVLAMLTAPALAPVAGHIRLSHPGDALLSSG
  SRFASKVAGLSGCHF

• Sequence length: 495

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ANDROGENETIC ALOPECIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	34030529	Associate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	34873418	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	30122881, 30929558, 31210410, 31811111, 31841454, 37259735	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	28925486, 29737580, 34396433	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	37158258	Inhibit	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	40141237	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	29286915, 31558183	Associate	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	30929558, 32373975, 34739394, 35419917	Associate	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	31680769		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	31841177	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	19220249		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	31115575		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	30272362, 30628646		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	31534348		★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	30945573	Associate	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	33577022, 35356854	Associate	★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	19220249		★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	36217332	Associate	★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	Pubtator	35782084	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	31558183		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	31391008, 32716346, 33103475, 33318296, 34872450	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	33002344, 37724892	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	36923215	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	29923329, 35642209	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	31841177	Associate	★☆☆☆☆ Found in Text Mining only