Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	23057
Gene name	Nicotinamide nucleotide adenylyltransferase 2
Gene symbol	NMNAT2
Synonyms (NCBI Gene)	C1orf15PNAT2
Chromosome	1
Chromosome location	1q25.3
Summary	This gene product belongs to the nicotinamide mononucleotide adenylyltransferase (NMNAT) enzyme family, members of which catalyze an essential step in NAD (NADP) biosynthetic pathway. Unlike the other human family member, which is localized to the nucleus

Show/Hide all (2)

SNP ID	Visualize variation	Clinical significance	Consequence
rs768849266	C>T	Likely-pathogenic	Missense variant, coding sequence variant
rs775499191	->G	Likely-pathogenic	Coding sequence variant, frameshift variant

226

Show/Hide all (226)

miRTarBase ID	miRNA	Experiments	Reference
MIRT021432	hsa-miR-9-5p	Microarray	17612493
MIRT023309	hsa-miR-122-5p	Microarray	17612493
MIRT040033	hsa-miR-615-3p	CLASH	23622248
MIRT040033	hsa-miR-615-3p	CLASH	23622248
MIRT620702	hsa-miR-4328	HITS-CLIP	23824327
MIRT620701	hsa-miR-4697-3p	HITS-CLIP	23824327
MIRT620700	hsa-miR-223-3p	HITS-CLIP	23824327
MIRT620699	hsa-miR-597-5p	HITS-CLIP	23824327
MIRT608050	hsa-miR-6867-5p	HITS-CLIP	23824327
MIRT626551	hsa-miR-3915	HITS-CLIP	23824327
MIRT626550	hsa-miR-1224-5p	HITS-CLIP	23824327
MIRT626549	hsa-miR-4689	HITS-CLIP	23824327
MIRT626548	hsa-miR-6858-5p	HITS-CLIP	23824327
MIRT620698	hsa-miR-592	HITS-CLIP	23824327
MIRT626547	hsa-miR-1304-5p	HITS-CLIP	23824327
MIRT608051	hsa-miR-574-5p	HITS-CLIP	23824327
MIRT635709	hsa-miR-6795-5p	HITS-CLIP	23824327
MIRT635708	hsa-miR-6887-5p	HITS-CLIP	23824327
MIRT635707	hsa-miR-328-5p	HITS-CLIP	23824327
MIRT635706	hsa-miR-6885-5p	HITS-CLIP	23824327
MIRT608050	hsa-miR-6867-5p	HITS-CLIP	23824327
MIRT635705	hsa-miR-6740-5p	HITS-CLIP	23824327
MIRT635704	hsa-miR-1275	HITS-CLIP	23824327
MIRT635703	hsa-miR-4665-5p	HITS-CLIP	23824327
MIRT635702	hsa-miR-7109-5p	HITS-CLIP	23824327
MIRT635701	hsa-miR-6751-5p	HITS-CLIP	23824327
MIRT635700	hsa-miR-6803-5p	HITS-CLIP	23824327
MIRT635699	hsa-miR-450a-2-3p	HITS-CLIP	23824327
MIRT635698	hsa-miR-4260	HITS-CLIP	23824327
MIRT635697	hsa-miR-5572	HITS-CLIP	23824327
MIRT635696	hsa-miR-4455	HITS-CLIP	23824327
MIRT608051	hsa-miR-574-5p	HITS-CLIP	23824327
MIRT620702	hsa-miR-4328	HITS-CLIP	23824327
MIRT620701	hsa-miR-4697-3p	HITS-CLIP	23824327
MIRT620700	hsa-miR-223-3p	HITS-CLIP	23824327
MIRT620699	hsa-miR-597-5p	HITS-CLIP	23824327
MIRT608050	hsa-miR-6867-5p	HITS-CLIP	23824327
MIRT626551	hsa-miR-3915	HITS-CLIP	23824327
MIRT626550	hsa-miR-1224-5p	HITS-CLIP	23824327
MIRT626549	hsa-miR-4689	HITS-CLIP	23824327
MIRT626548	hsa-miR-6858-5p	HITS-CLIP	23824327
MIRT620698	hsa-miR-592	HITS-CLIP	23824327
MIRT626547	hsa-miR-1304-5p	HITS-CLIP	23824327
MIRT608051	hsa-miR-574-5p	HITS-CLIP	23824327
MIRT620702	hsa-miR-4328	HITS-CLIP	23824327
MIRT620701	hsa-miR-4697-3p	HITS-CLIP	23824327
MIRT620700	hsa-miR-223-3p	HITS-CLIP	23824327
MIRT620699	hsa-miR-597-5p	HITS-CLIP	23824327
MIRT608050	hsa-miR-6867-5p	HITS-CLIP	23824327
MIRT620698	hsa-miR-592	HITS-CLIP	23824327
MIRT608051	hsa-miR-574-5p	HITS-CLIP	23824327
MIRT609015	hsa-miR-5089-3p	HITS-CLIP	24906430
MIRT608051	hsa-miR-574-5p	HITS-CLIP	24906430
MIRT608050	hsa-miR-6867-5p	HITS-CLIP	24906430
MIRT635704	hsa-miR-1275	HITS-CLIP	27418678
MIRT635704	hsa-miR-1275	HITS-CLIP	27418678
MIRT635704	hsa-miR-1275	HITS-CLIP	27418678
MIRT620700	hsa-miR-223-3p	HITS-CLIP	27418678
MIRT635707	hsa-miR-328-5p	HITS-CLIP	27418678
MIRT635707	hsa-miR-328-5p	HITS-CLIP	27418678
MIRT635707	hsa-miR-328-5p	HITS-CLIP	27418678
MIRT635698	hsa-miR-4260	HITS-CLIP	27418678
MIRT635698	hsa-miR-4260	HITS-CLIP	27418678
MIRT635698	hsa-miR-4260	HITS-CLIP	27418678
MIRT635696	hsa-miR-4455	HITS-CLIP	27418678
MIRT635696	hsa-miR-4455	HITS-CLIP	27418678
MIRT635696	hsa-miR-4455	HITS-CLIP	27418678
MIRT635699	hsa-miR-450a-2-3p	HITS-CLIP	27418678
MIRT635699	hsa-miR-450a-2-3p	HITS-CLIP	27418678
MIRT635699	hsa-miR-450a-2-3p	HITS-CLIP	27418678
MIRT635703	hsa-miR-4665-5p	HITS-CLIP	27418678
MIRT635703	hsa-miR-4665-5p	HITS-CLIP	27418678
MIRT635703	hsa-miR-4665-5p	HITS-CLIP	27418678
MIRT620701	hsa-miR-4697-3p	HITS-CLIP	27418678
MIRT635697	hsa-miR-5572	HITS-CLIP	27418678
MIRT635697	hsa-miR-5572	HITS-CLIP	27418678
MIRT635697	hsa-miR-5572	HITS-CLIP	27418678
MIRT608051	hsa-miR-574-5p	HITS-CLIP	27418678
MIRT608051	hsa-miR-574-5p	HITS-CLIP	27418678
MIRT608051	hsa-miR-574-5p	HITS-CLIP	27418678
MIRT620698	hsa-miR-592	HITS-CLIP	27418678
MIRT620699	hsa-miR-597-5p	HITS-CLIP	27418678
MIRT635705	hsa-miR-6740-5p	HITS-CLIP	27418678
MIRT635705	hsa-miR-6740-5p	HITS-CLIP	27418678
MIRT635705	hsa-miR-6740-5p	HITS-CLIP	27418678
MIRT635701	hsa-miR-6751-5p	HITS-CLIP	27418678
MIRT635701	hsa-miR-6751-5p	HITS-CLIP	27418678
MIRT635701	hsa-miR-6751-5p	HITS-CLIP	27418678
MIRT635709	hsa-miR-6795-5p	HITS-CLIP	27418678
MIRT635709	hsa-miR-6795-5p	HITS-CLIP	27418678
MIRT635709	hsa-miR-6795-5p	HITS-CLIP	27418678
MIRT635700	hsa-miR-6803-5p	HITS-CLIP	27418678
MIRT635700	hsa-miR-6803-5p	HITS-CLIP	27418678
MIRT635700	hsa-miR-6803-5p	HITS-CLIP	27418678
MIRT608050	hsa-miR-6867-5p	HITS-CLIP	27418678
MIRT608050	hsa-miR-6867-5p	HITS-CLIP	27418678
MIRT608050	hsa-miR-6867-5p	HITS-CLIP	27418678
MIRT608050	hsa-miR-6867-5p	HITS-CLIP	27418678
MIRT635706	hsa-miR-6885-5p	HITS-CLIP	27418678
MIRT635706	hsa-miR-6885-5p	HITS-CLIP	27418678
MIRT635706	hsa-miR-6885-5p	HITS-CLIP	27418678
MIRT635708	hsa-miR-6887-5p	HITS-CLIP	27418678
MIRT635708	hsa-miR-6887-5p	HITS-CLIP	27418678
MIRT635708	hsa-miR-6887-5p	HITS-CLIP	27418678
MIRT635702	hsa-miR-7109-5p	HITS-CLIP	27418678
MIRT635702	hsa-miR-7109-5p	HITS-CLIP	27418678
MIRT635702	hsa-miR-7109-5p	HITS-CLIP	27418678
MIRT620702	hsa-miR-4328	HITS-CLIP	23824327
MIRT620701	hsa-miR-4697-3p	HITS-CLIP	23824327
MIRT620700	hsa-miR-223-3p	HITS-CLIP	23824327
MIRT620699	hsa-miR-597-5p	HITS-CLIP	23824327
MIRT608050	hsa-miR-6867-5p	HITS-CLIP	23824327
MIRT626551	hsa-miR-3915	HITS-CLIP	23824327
MIRT626550	hsa-miR-1224-5p	HITS-CLIP	23824327
MIRT626549	hsa-miR-4689	HITS-CLIP	23824327
MIRT626548	hsa-miR-6858-5p	HITS-CLIP	23824327
MIRT620698	hsa-miR-592	HITS-CLIP	23824327
MIRT626547	hsa-miR-1304-5p	HITS-CLIP	23824327
MIRT608051	hsa-miR-574-5p	HITS-CLIP	23824327
MIRT635709	hsa-miR-6795-5p	HITS-CLIP	23824327
MIRT635708	hsa-miR-6887-5p	HITS-CLIP	23824327
MIRT635707	hsa-miR-328-5p	HITS-CLIP	23824327
MIRT635706	hsa-miR-6885-5p	HITS-CLIP	23824327
MIRT608050	hsa-miR-6867-5p	HITS-CLIP	23824327
MIRT635705	hsa-miR-6740-5p	HITS-CLIP	23824327
MIRT635704	hsa-miR-1275	HITS-CLIP	23824327
MIRT635703	hsa-miR-4665-5p	HITS-CLIP	23824327
MIRT635702	hsa-miR-7109-5p	HITS-CLIP	23824327
MIRT635701	hsa-miR-6751-5p	HITS-CLIP	23824327
MIRT635700	hsa-miR-6803-5p	HITS-CLIP	23824327
MIRT635699	hsa-miR-450a-2-3p	HITS-CLIP	23824327
MIRT635698	hsa-miR-4260	HITS-CLIP	23824327
MIRT635697	hsa-miR-5572	HITS-CLIP	23824327
MIRT635696	hsa-miR-4455	HITS-CLIP	23824327
MIRT608051	hsa-miR-574-5p	HITS-CLIP	23824327
MIRT620702	hsa-miR-4328	HITS-CLIP	23824327
MIRT620701	hsa-miR-4697-3p	HITS-CLIP	23824327
MIRT620700	hsa-miR-223-3p	HITS-CLIP	23824327
MIRT620699	hsa-miR-597-5p	HITS-CLIP	23824327
MIRT608050	hsa-miR-6867-5p	HITS-CLIP	23824327
MIRT626551	hsa-miR-3915	HITS-CLIP	23824327
MIRT626550	hsa-miR-1224-5p	HITS-CLIP	23824327
MIRT626549	hsa-miR-4689	HITS-CLIP	23824327
MIRT626548	hsa-miR-6858-5p	HITS-CLIP	23824327
MIRT620698	hsa-miR-592	HITS-CLIP	23824327
MIRT626547	hsa-miR-1304-5p	HITS-CLIP	23824327
MIRT608051	hsa-miR-574-5p	HITS-CLIP	23824327
MIRT620702	hsa-miR-4328	HITS-CLIP	23824327
MIRT620701	hsa-miR-4697-3p	HITS-CLIP	23824327
MIRT620700	hsa-miR-223-3p	HITS-CLIP	23824327
MIRT620699	hsa-miR-597-5p	HITS-CLIP	23824327
MIRT608050	hsa-miR-6867-5p	HITS-CLIP	23824327
MIRT620698	hsa-miR-592	HITS-CLIP	23824327
MIRT608051	hsa-miR-574-5p	HITS-CLIP	23824327
MIRT1187807	hsa-miR-1268	CLIP-seq
MIRT1187808	hsa-miR-1268b	CLIP-seq
MIRT1187809	hsa-miR-129-5p	CLIP-seq
MIRT1187810	hsa-miR-1304	CLIP-seq
MIRT1187811	hsa-miR-2052	CLIP-seq
MIRT1187812	hsa-miR-219-2-3p	CLIP-seq
MIRT1187813	hsa-miR-223	CLIP-seq
MIRT1187814	hsa-miR-2964a-3p	CLIP-seq
MIRT1187815	hsa-miR-3120-3p	CLIP-seq
MIRT1187816	hsa-miR-3141	CLIP-seq
MIRT1187817	hsa-miR-3150b-3p	CLIP-seq
MIRT1187818	hsa-miR-330-3p	CLIP-seq
MIRT1187819	hsa-miR-425	CLIP-seq
MIRT1187820	hsa-miR-4462	CLIP-seq
MIRT1187821	hsa-miR-4477a	CLIP-seq
MIRT1187822	hsa-miR-4784	CLIP-seq
MIRT1187823	hsa-miR-587	CLIP-seq
MIRT1187824	hsa-miR-597	CLIP-seq
MIRT1187825	hsa-miR-1252	CLIP-seq
MIRT1187826	hsa-miR-1265	CLIP-seq
MIRT1187827	hsa-miR-141	CLIP-seq
MIRT1187828	hsa-miR-185	CLIP-seq
MIRT1187829	hsa-miR-200a	CLIP-seq
MIRT1187830	hsa-miR-3677-5p	CLIP-seq
MIRT1187831	hsa-miR-3942-3p	CLIP-seq
MIRT1187832	hsa-miR-4306	CLIP-seq
MIRT1187833	hsa-miR-4446-5p	CLIP-seq
MIRT1187834	hsa-miR-4644	CLIP-seq
MIRT1187835	hsa-miR-4684-3p	CLIP-seq
MIRT2054397	hsa-miR-1251	CLIP-seq
MIRT2054398	hsa-miR-1281	CLIP-seq
MIRT2054399	hsa-miR-138	CLIP-seq
MIRT2054400	hsa-miR-2278	CLIP-seq
MIRT2054401	hsa-miR-2355-5p	CLIP-seq
MIRT2054402	hsa-miR-2392	CLIP-seq
MIRT2054403	hsa-miR-3183	CLIP-seq
MIRT2054404	hsa-miR-3184	CLIP-seq
MIRT2054405	hsa-miR-3614-3p	CLIP-seq
MIRT2054406	hsa-miR-3619-3p	CLIP-seq
MIRT2054407	hsa-miR-423-5p	CLIP-seq
MIRT2054408	hsa-miR-4261	CLIP-seq
MIRT2054409	hsa-miR-4299	CLIP-seq
MIRT2054410	hsa-miR-4496	CLIP-seq
MIRT2054411	hsa-miR-4688	CLIP-seq
MIRT2054412	hsa-miR-4723-3p	CLIP-seq
MIRT2054413	hsa-miR-4779	CLIP-seq
MIRT2054414	hsa-miR-518d-5p	CLIP-seq
MIRT2054415	hsa-miR-519b-5p	CLIP-seq
MIRT2054416	hsa-miR-519c-5p	CLIP-seq
MIRT2054417	hsa-miR-520c-5p	CLIP-seq
MIRT2054418	hsa-miR-526a	CLIP-seq
MIRT2054419	hsa-miR-642a	CLIP-seq
MIRT2283485	hsa-miR-4269	CLIP-seq
MIRT2283486	hsa-miR-4514	CLIP-seq
MIRT2283487	hsa-miR-4692	CLIP-seq
MIRT2283488	hsa-miR-4742-5p	CLIP-seq
MIRT2283489	hsa-miR-210	CLIP-seq
MIRT2283490	hsa-miR-3064-5p	CLIP-seq
MIRT2054406	hsa-miR-3619-3p	CLIP-seq
MIRT2283491	hsa-miR-3661	CLIP-seq
MIRT2283492	hsa-miR-3690	CLIP-seq
MIRT2283493	hsa-miR-4776-5p	CLIP-seq
MIRT2283494	hsa-miR-619	CLIP-seq
MIRT2283495	hsa-miR-631	CLIP-seq
MIRT2581674	hsa-miR-3671	CLIP-seq
MIRT2581675	hsa-miR-4251	CLIP-seq
MIRT2581676	hsa-miR-4303	CLIP-seq
MIRT2581677	hsa-miR-4329	CLIP-seq
MIRT2581678	hsa-miR-4778-5p	CLIP-seq
MIRT2581679	hsa-miR-539	CLIP-seq
MIRT2581680	hsa-miR-607	CLIP-seq
MIRT2581681	hsa-miR-944	CLIP-seq

Show/Hide all (1)

Transcription factor	Regulation	Reference
CREB1	Unknown	22027994

Show/Hide all (42)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000139	Component	Golgi membrane	IEA
GO:0000139	Component	Golgi membrane	TAS
GO:0000166	Function	Nucleotide binding	IEA
GO:0000309	Function	Nicotinamide-nucleotide adenylyltransferase activity	IBA
GO:0000309	Function	Nicotinamide-nucleotide adenylyltransferase activity	IEA
GO:0002181	Process	Cytoplasmic translation	IDA	8706699, 32669547, 34314702
GO:0003824	Function	Catalytic activity	IEA
GO:0004515	Function	Nicotinate-nucleotide adenylyltransferase activity	IBA
GO:0004515	Function	Nicotinate-nucleotide adenylyltransferase activity	IDA	16118205
GO:0004515	Function	Nicotinate-nucleotide adenylyltransferase activity	IEA
GO:0005524	Function	ATP binding	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005770	Component	Late endosome	IEA
GO:0005794	Component	Golgi apparatus	IBA
GO:0005794	Component	Golgi apparatus	IDA	16118205
GO:0005794	Component	Golgi apparatus	IEA
GO:0005802	Component	Trans-Golgi network	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	IEA
GO:0006741	Process	NADP+ biosynthetic process	IEA
GO:0006769	Process	Nicotinamide metabolic process	IEA
GO:0009165	Process	Nucleotide biosynthetic process	IC	16118205
GO:0009435	Process	NAD+ biosynthetic process	IBA
GO:0009435	Process	NAD+ biosynthetic process	IEA
GO:0016020	Component	Membrane	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0016779	Function	Nucleotidyltransferase activity	IEA
GO:0019363	Process	Pyridine nucleotide biosynthetic process	IEA
GO:0019898	Component	Extrinsic component of membrane	IEA
GO:0030133	Component	Transport vesicle	IEA
GO:0030424	Component	Axon	IEA
GO:0030659	Component	Cytoplasmic vesicle membrane	IEA
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0034354	Process	'de novo' NAD+ biosynthetic process from L-tryptophan	IEA
GO:0034355	Process	NAD+ biosynthetic process via the salvage pathway	IEA
GO:0042995	Component	Cell projection	IEA
GO:0045202	Component	Synapse	IEA
GO:0061564	Process	Axon development	ISS	30304512
GO:0090407	Process	Organophosphate biosynthetic process	IEA
GO:0140768	Function	Protein ADP-ribosyltransferase-substrate adaptor activity	IDA	34314702
GO:2000766	Process	Negative regulation of cytoplasmic translation	IDA	34314702
GO:2000766	Process	Negative regulation of cytoplasmic translation	IDA	34314702

MIM	HGNC	e!Ensembl
608701	16789	ENSG00000157064

Q9BZQ4

Protein name

Nicotinamide/nicotinic acid mononucleotide adenylyltransferase 2 (NMN/NaMN adenylyltransferase 2) (EC 2.7.7.1) (EC 2.7.7.18) (Nicotinamide mononucleotide adenylyltransferase 2) (NMN adenylyltransferase 2) (Nicotinate-nucleotide adenylyltransferase 2) (NaM

Protein function

Nicotinamide/nicotinate-nucleotide adenylyltransferase that acts as an axon maintenance factor (By similarity). Axon survival factor required for the maintenance of healthy axons: acts by delaying Wallerian axon degeneration, an evolutionarily c

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01467	CTP_transf_like	12 → 276	Cytidylyltransferase-like	Domain

Tissue specificity

TISSUE SPECIFICITY: Highly expressed in brain, in particular in cerebrum, cerebellum, occipital lobe, frontal lobe, temporal lobe and putamen. Also found in the heart, skeletal muscle, pancreas and islets of Langerhans. {ECO:0000269|PubMed:12359228, ECO:0

Sequence

MTETTKTHVILLACGSFNPITKGHIQMFERARDYLHKTGRFIVIGGIVSPVHDSYGKQGL
VSSRHRLIMCQLAVQNSDWIRVDPWECYQDTWQTTCSVLEHHRDLMKRVTGCILSNVNTP
SMTPVIGQPQNETPQPIYQNSNVATKPTAAKILGKVGESLSRICCVRPPVERFTFVDENA
NLGTVMRYEEIELRILLLCGSDLLESFCIPGLWNEADMEVIVGDFGIVVVPRDAADTDRI
MNHSSILRKYKNNIMVVKDDINHPMSVVSSTKSRLALQHGDGHVVDYLSQPVIDYILKSQ
LYINASG

Sequence length

307

Interactions

View interactions

	KEGG		Reactome
	Nicotinate and nicotinamide metabolism Metabolic pathways Biosynthesis of cofactors		Nicotinate metabolism

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (8)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
COLOR VISION DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEMENTIA, VASCULAR	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC LUPUS ERYTHEMATOSUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 1 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Vascular dementia	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (39)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Alzheimer disease, familial, type 3	Alzheimer disease	BEFREE	27254664		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Stem Neoplasms	Brain stem neoplasms	Pubtator	28544218	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	27218101	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebellar Hypoplasia	Cerebellar Hypoplasia	GENOMICS_ENGLAND_DG	23082226, 31136762		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	BEFREE	22027994		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	30333863		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	27218101	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	38092774	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic retinopathy	Pubtator	38222451	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dysmorphic features	Dysmorphic Features	CLINVAR_DG	12359228, 12574164, 14516279, 16118205, 20943658, 21615689, 21940452, 22842230, 23082226, 24284888, 24840802, 25560765, 28035283		★★★★★ ★☆☆☆☆ Found in Text Mining only
Erythromelalgia	Erythromelalgia	BEFREE	31132363		★★★★★ ★☆☆☆☆ Found in Text Mining only
Erythromelalgia	Erythromelalgia	GENOMICS_ENGLAND_DG	31132363, 31136762		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hydrocephalus	Hydrocephalus	GENOMICS_ENGLAND_DG	23082226, 31136762		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hydrops Fetalis	Hydrops Fetalis	GENOMICS_ENGLAND_DG	23082226, 31136762		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hydrops of placenta	Hydropic placenta	GENOMICS_ENGLAND_DG	23082226, 31136762		★★★★★ ★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	22027994		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	26783109	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	GWASDB_DG	18204446		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	26783109		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	GWASCAT_DG	28714469		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphangioma, Cystic	Cystic hygroma	GENOMICS_ENGLAND_DG	23082226, 31136762		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	30333863		★★★★★ ★☆☆☆☆ Found in Text Mining only
Micrognathism	Micrognathism	GENOMICS_ENGLAND_DG	23082226, 31136762		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial Diseases	BEFREE	31740269		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	BEFREE	28855716		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple congenital anomalies	Multiple Congenital Anomalies	CLINVAR_DG	12359228, 12574164, 14516279, 16118205, 20943658, 21615689, 21940452, 22842230, 23082226, 24284888, 24840802, 25560765, 28035283		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	30333863		★★★★★ ★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	28266613		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	29478906		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	30278188		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nonorganic psychosis	Nonorganic Psychosis	BEFREE	28544218		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pena-Shokeir syndrome type I	Pena Shokeir syndrome	BEFREE	31136762		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral Nervous System Diseases	Nervous System Diseases	BEFREE	29567804		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral Neuropathy	Peripheral Neuropathy	BEFREE	29567804		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polyneuropathy	Polyneuropathy	BEFREE	31132363		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polyneuropathy	Polyneuropathy	GENOMICS_ENGLAND_DG	31132363, 31136762		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychosis	BEFREE	28544218		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychotic disorders	Pubtator	28544218	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Tauopathies	Tauopathies	BEFREE	22027994		★★★★★ ★☆☆☆☆ Found in Text Mining only

NMNAT2 (nicotinamide nucleotide adenylyltransferase 2)