Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	23054
Gene name	Nuclear receptor coactivator 6
Gene symbol	NCOA6
Synonyms (NCBI Gene)	AIB3ASC2NRCPRIPRAP250TRBP
Chromosome	20
Chromosome location	20q11.22
Summary	The protein encoded by this gene is a transcriptional coactivator that can interact with nuclear hormone receptors to enhance their transcriptional activator functions. This protein has been shown to be involved in the hormone-dependent coactivation of se

164

Show/Hide all (164)

miRTarBase ID	miRNA	Experiments	Reference
MIRT003235	hsa-miR-224-5p	Luciferase reporter assay	20065103
MIRT023418	hsa-miR-30b-5p	Sequencing	20371350
MIRT028192	hsa-miR-33a-5p	Sequencing	20371350
MIRT031325	hsa-miR-18a-5p	Sequencing	20371350
MIRT044079	hsa-miR-361-5p	CLASH	23622248
MIRT036743	hsa-miR-760	CLASH	23622248
MIRT440129	hsa-miR-374a-5p	HITS-CLIP	22473208
MIRT439122	hsa-miR-10b-5p	3'LIFE	25074381
MIRT440129	hsa-miR-374a-5p	HITS-CLIP	22473208
MIRT439122	hsa-miR-10b-5p	3'LIFE	25074381
MIRT1177332	hsa-miR-10a	CLIP-seq
MIRT1177333	hsa-miR-10b	CLIP-seq
MIRT1177334	hsa-miR-1178	CLIP-seq
MIRT1177335	hsa-miR-224	CLIP-seq
MIRT1177336	hsa-miR-302f	CLIP-seq
MIRT1177337	hsa-miR-3620	CLIP-seq
MIRT1177338	hsa-miR-371b-5p	CLIP-seq
MIRT1177339	hsa-miR-3929	CLIP-seq
MIRT1177340	hsa-miR-4266	CLIP-seq
MIRT1177341	hsa-miR-4282	CLIP-seq
MIRT1177342	hsa-miR-4419b	CLIP-seq
MIRT1177343	hsa-miR-4477a	CLIP-seq
MIRT1177344	hsa-miR-4478	CLIP-seq
MIRT1177345	hsa-miR-4637	CLIP-seq
MIRT1177346	hsa-miR-4683	CLIP-seq
MIRT1177347	hsa-miR-4698	CLIP-seq
MIRT1177348	hsa-miR-4803	CLIP-seq
MIRT1177349	hsa-miR-486-5p	CLIP-seq
MIRT1177350	hsa-miR-499-3p	CLIP-seq
MIRT1177351	hsa-miR-499a-3p	CLIP-seq
MIRT1177352	hsa-miR-548c-3p	CLIP-seq
MIRT1177353	hsa-miR-645	CLIP-seq
MIRT2051325	hsa-miR-1283	CLIP-seq
MIRT2051326	hsa-miR-3065-5p	CLIP-seq
MIRT2051327	hsa-miR-374a	CLIP-seq
MIRT2051328	hsa-miR-374b	CLIP-seq
MIRT2051329	hsa-miR-377	CLIP-seq
MIRT2051330	hsa-miR-4496	CLIP-seq
MIRT2280417	hsa-miR-101	CLIP-seq
MIRT1177332	hsa-miR-10a	CLIP-seq
MIRT1177333	hsa-miR-10b	CLIP-seq
MIRT1177334	hsa-miR-1178	CLIP-seq
MIRT2280418	hsa-miR-1253	CLIP-seq
MIRT2051325	hsa-miR-1283	CLIP-seq
MIRT2280419	hsa-miR-132	CLIP-seq
MIRT2280420	hsa-miR-1909	CLIP-seq
MIRT2280421	hsa-miR-1910	CLIP-seq
MIRT2280422	hsa-miR-212	CLIP-seq
MIRT1177335	hsa-miR-224	CLIP-seq
MIRT2280423	hsa-miR-2355-5p	CLIP-seq
MIRT2280424	hsa-miR-23a	CLIP-seq
MIRT2280425	hsa-miR-23b	CLIP-seq
MIRT2280426	hsa-miR-23c	CLIP-seq
MIRT2280427	hsa-miR-25	CLIP-seq
MIRT1177336	hsa-miR-302f	CLIP-seq
MIRT2051326	hsa-miR-3065-5p	CLIP-seq
MIRT2280428	hsa-miR-3140-3p	CLIP-seq
MIRT2280429	hsa-miR-3160-5p	CLIP-seq
MIRT2280430	hsa-miR-3163	CLIP-seq
MIRT2280431	hsa-miR-32	CLIP-seq
MIRT2280432	hsa-miR-3591-3p	CLIP-seq
MIRT1177337	hsa-miR-3620	CLIP-seq
MIRT2280433	hsa-miR-363	CLIP-seq
MIRT2280434	hsa-miR-367	CLIP-seq
MIRT2280435	hsa-miR-3679-3p	CLIP-seq
MIRT2280436	hsa-miR-3691-3p	CLIP-seq
MIRT2280437	hsa-miR-369-3p	CLIP-seq
MIRT2280438	hsa-miR-370	CLIP-seq
MIRT1177338	hsa-miR-371b-5p	CLIP-seq
MIRT2051327	hsa-miR-374a	CLIP-seq
MIRT2051328	hsa-miR-374b	CLIP-seq
MIRT2051329	hsa-miR-377	CLIP-seq
MIRT2280439	hsa-miR-410	CLIP-seq
MIRT2280440	hsa-miR-421	CLIP-seq
MIRT1177340	hsa-miR-4266	CLIP-seq
MIRT1177341	hsa-miR-4282	CLIP-seq
MIRT2280441	hsa-miR-4286	CLIP-seq
MIRT2280442	hsa-miR-4301	CLIP-seq
MIRT2280443	hsa-miR-4313	CLIP-seq
MIRT2280444	hsa-miR-4325	CLIP-seq
MIRT2280445	hsa-miR-4420	CLIP-seq
MIRT2280446	hsa-miR-4437	CLIP-seq
MIRT1177343	hsa-miR-4477a	CLIP-seq
MIRT2051330	hsa-miR-4496	CLIP-seq
MIRT1177345	hsa-miR-4637	CLIP-seq
MIRT1177346	hsa-miR-4683	CLIP-seq
MIRT1177347	hsa-miR-4698	CLIP-seq
MIRT2280447	hsa-miR-4699-3p	CLIP-seq
MIRT2280448	hsa-miR-4699-5p	CLIP-seq
MIRT2280449	hsa-miR-4709-5p	CLIP-seq
MIRT2280450	hsa-miR-4753-3p	CLIP-seq
MIRT2280451	hsa-miR-4760-5p	CLIP-seq
MIRT1177349	hsa-miR-486-5p	CLIP-seq
MIRT2280452	hsa-miR-494	CLIP-seq
MIRT1177350	hsa-miR-499-3p	CLIP-seq
MIRT1177351	hsa-miR-499a-3p	CLIP-seq
MIRT2280453	hsa-miR-500a	CLIP-seq
MIRT1177352	hsa-miR-548c-3p	CLIP-seq
MIRT2280454	hsa-miR-548n	CLIP-seq
MIRT2280455	hsa-miR-548t	CLIP-seq
MIRT2280456	hsa-miR-92a	CLIP-seq
MIRT2280457	hsa-miR-92b	CLIP-seq
MIRT2280458	hsa-miR-944	CLIP-seq
MIRT1177350	hsa-miR-499-3p	CLIP-seq
MIRT1177351	hsa-miR-499a-3p	CLIP-seq
MIRT2280453	hsa-miR-500a	CLIP-seq
MIRT1177332	hsa-miR-10a	CLIP-seq
MIRT1177333	hsa-miR-10b	CLIP-seq
MIRT1177334	hsa-miR-1178	CLIP-seq
MIRT2578885	hsa-miR-1256	CLIP-seq
MIRT2280420	hsa-miR-1909	CLIP-seq
MIRT2578886	hsa-miR-3143	CLIP-seq
MIRT1177337	hsa-miR-3620	CLIP-seq
MIRT2051327	hsa-miR-374a	CLIP-seq
MIRT2051328	hsa-miR-374b	CLIP-seq
MIRT2578887	hsa-miR-3923	CLIP-seq
MIRT1177339	hsa-miR-3929	CLIP-seq
MIRT1177340	hsa-miR-4266	CLIP-seq
MIRT1177341	hsa-miR-4282	CLIP-seq
MIRT1177342	hsa-miR-4419b	CLIP-seq
MIRT2578888	hsa-miR-4448	CLIP-seq
MIRT1177343	hsa-miR-4477a	CLIP-seq
MIRT1177344	hsa-miR-4478	CLIP-seq
MIRT2051330	hsa-miR-4496	CLIP-seq
MIRT1177346	hsa-miR-4683	CLIP-seq
MIRT2578889	hsa-miR-4729	CLIP-seq
MIRT1177349	hsa-miR-486-5p	CLIP-seq
MIRT2280452	hsa-miR-494	CLIP-seq
MIRT1177350	hsa-miR-499-3p	CLIP-seq
MIRT1177351	hsa-miR-499a-3p	CLIP-seq
MIRT2578890	hsa-miR-543	CLIP-seq
MIRT1177352	hsa-miR-548c-3p	CLIP-seq
MIRT2578891	hsa-miR-570	CLIP-seq
MIRT2578892	hsa-miR-628-3p	CLIP-seq
MIRT1177353	hsa-miR-645	CLIP-seq
MIRT2578893	hsa-miR-802	CLIP-seq
MIRT1177332	hsa-miR-10a	CLIP-seq
MIRT1177333	hsa-miR-10b	CLIP-seq
MIRT1177334	hsa-miR-1178	CLIP-seq
MIRT2578885	hsa-miR-1256	CLIP-seq
MIRT2280420	hsa-miR-1909	CLIP-seq
MIRT2578886	hsa-miR-3143	CLIP-seq
MIRT1177337	hsa-miR-3620	CLIP-seq
MIRT2051327	hsa-miR-374a	CLIP-seq
MIRT2051328	hsa-miR-374b	CLIP-seq
MIRT2578887	hsa-miR-3923	CLIP-seq
MIRT1177339	hsa-miR-3929	CLIP-seq
MIRT1177340	hsa-miR-4266	CLIP-seq
MIRT1177342	hsa-miR-4419b	CLIP-seq
MIRT2578888	hsa-miR-4448	CLIP-seq
MIRT1177344	hsa-miR-4478	CLIP-seq
MIRT2051330	hsa-miR-4496	CLIP-seq
MIRT1177346	hsa-miR-4683	CLIP-seq
MIRT2578889	hsa-miR-4729	CLIP-seq
MIRT1177349	hsa-miR-486-5p	CLIP-seq
MIRT2280452	hsa-miR-494	CLIP-seq
MIRT1177350	hsa-miR-499-3p	CLIP-seq
MIRT1177351	hsa-miR-499a-3p	CLIP-seq
MIRT2578890	hsa-miR-543	CLIP-seq
MIRT1177352	hsa-miR-548c-3p	CLIP-seq
MIRT2578891	hsa-miR-570	CLIP-seq
MIRT2578892	hsa-miR-628-3p	CLIP-seq
MIRT1177353	hsa-miR-645	CLIP-seq
MIRT2578893	hsa-miR-802	CLIP-seq

Show/Hide all (30)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003682	Function	Chromatin binding	ISS
GO:0003713	Function	Transcription coactivator activity	IBA
GO:0003713	Function	Transcription coactivator activity	IDA	10567404, 11443112
GO:0003713	Function	Transcription coactivator activity	IEA
GO:0003713	Function	Transcription coactivator activity	IPI	11443112
GO:0005515	Function	Protein binding	IPI	10866662, 11443112, 12482968, 14645241, 17021013, 17178841, 17500065, 17925232, 19047629, 19433796, 23870121, 24981860, 27705803, 28514442, 33640491, 33961781
GO:0005634	Component	Nucleus	IDA	11443112, 17500065
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	NAS	10567404
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005667	Component	Transcription regulator complex	IBA
GO:0005667	Component	Transcription regulator complex	TAS	11443112
GO:0005829	Component	Cytosol	IDA
GO:0006352	Process	DNA-templated transcription initiation	IDA	10567404
GO:0006974	Process	DNA damage response	IDA	17500065
GO:0007420	Process	Brain development	ISS
GO:0007507	Process	Heart development	ISS
GO:0009725	Process	Response to hormone	TAS	11443112
GO:0019899	Function	Enzyme binding	IPI	12039952
GO:0030099	Process	Myeloid cell differentiation	IDA	11302752
GO:0030331	Function	Nuclear estrogen receptor binding	TAS	11443112
GO:0035097	Component	Histone methyltransferase complex	IBA
GO:0035097	Component	Histone methyltransferase complex	IDA	17500065
GO:0044666	Component	MLL3/4 complex	IPI	23508102
GO:0045893	Process	Positive regulation of DNA-templated transcription	TAS	12519782
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IBA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	11443112
GO:0046965	Function	Nuclear retinoid X receptor binding	TAS	11443112
GO:0046966	Function	Nuclear thyroid hormone receptor binding	IDA	11443112

MIM	HGNC	e!Ensembl
605299	15936	ENSG00000198646

Q14686

Protein name

Nuclear receptor coactivator 6 (Activating signal cointegrator 2) (ASC-2) (Amplified in breast cancer protein 3) (Cancer-amplified transcriptional coactivator ASC-2) (Nuclear receptor coactivator RAP250) (NRC RAP250) (Nuclear receptor-activating protein,

Protein function

Nuclear receptor coactivator that directly binds nuclear receptors and stimulates the transcriptional activities in a hormone-dependent fashion. Coactivates expression in an agonist- and AF2-dependent manner. Involved in the coactivation of diff

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF13820	Nucleic_acid_bd	47 → 190	Putative nucleic acid-binding region	Family

Tissue specificity

TISSUE SPECIFICITY: Ubiquitous. Highly expressed in brain, prostate, testis and ovary; weakly expressed in lung, thymus and small intestine.

Sequence

MVLDDLPNLEDIYTSLCSSTMEDSEMDFDSGLEDDDTKSDSILEDSTIFVAFKGNIDDKD
FKWKLDAILKNVPNLLHMESSKLKVQKVEPWNSVRVTFNIPREAAERLRILAQSNNQQLR
DLGILSVQIEGEGAINLALAQNRSQDVRMNGPMGAGNSVRMEAGFPMASGPGIIRMNNPA
TVMIPPGGNVSSSMMAPGPNPELQPRTPRPASQSDAMDPLLSGLHIQQQSHPSGSLAPPH
HPMQPVSVNRQMNPANFPQLQQQQQQQQQQQQQQQQQQQQQQQQQLQARPPQQHQQQQPQ
GIRPQFTAPTQVPVPPGWNQLPSGALQPPPAQGSLGTMTANQGWKKAPLPGPMQQQLQAR
PSLATVQTPSHPPPPYPFGSQQASQAHTNFPQMSNPGQFTAPQMKSLQGGPSRVPTPLQQ
PHLTNKSPASSPSSFQQGSPASSPTVNQTQQQMGPRPPQNNPLPQGFQQPVSSPGRNPMV
QQGNVPPNFMVMQQQPPNQGPQSLHPGLGGMPKRLPPGFSAGQANPNFMQGQVPSTTATT
PGNSGAPQLQANQNVQHAGGQGAGPPQNQMQVSHGPPNMMQPSLMGIHGNMNNQQAGTSG
VPQVNLSNMQGQPQQGPPSQLMGMHQQIVPSQGQMVQQQGTLNPQNPMILSRAQLMPQGQ
MMVNPPSQNLGPSPQRMTPPKQMLSQQGPQMMAPHNQMMGPQGQVLLQQNPMIEQIMTNQ
MQGNKQQFNTQNQSNVMPGPAQIMRGPTPNMQGNMVQFTGQMSGQMLPQQGPVNNSPSQV
MGIQGQVLRPPGPSPHMAQQHGDPATTANNDVSLSQMMPDVSIQQTNMVPPHVQAMQGNS
ASGNHFSGHGMSFNAPFSGAPNGNQMSCGQNPGFPVNKDVTLTSPLLVNLLQSDISAGHF
GVNNKQNNTNANKPKKKKPPRKKKNSQQDLNTPDTRPAGLEEADQPPLPGEQGINLDNSG
PKLPEFSNRPPGYPSQPVEQRPLQQMPPQLMQHVAPPPQPPQQQPQPQLPQQQQPPPPSQ
PQSQQQQQQQQQMMMMLMMQQDPKSVRLPVSQNVHPPRGPLNPDSQRMPMQQSGSVPVMV
SLQGPASVPPSPDKQRMPMPVNTPLGSNSRKMVYQESPQNPSSSPLAEMASLPEASGSEA
PSVPGGPNNMPSHVVLPQNQLMMTGPKPGPSPLSATQGATPQQPPVNSLPSSHGHHFPNV
AAPTQTSRPKTPNRASPRPYYPQTPNNRPPSTEPSEISLSPERLNASIAGLFPPQINIPL
PPRPNLNRGFDQQGLNPTTLKAIGQAPSNLTMNPSNFATPQTHKLDSVVVNSGKQSNSGA
TKRASPSNSRRSSPGSSRKTTPSPGRQNSKAPKLTLASQTNAALLQNVELPRNVLVSPTP
LANPPVPGSFPNNSGLNPQNSTVSVAAVGGVVEDNKESLNVPQDSDCQNSQSRKEQVNIE
LKAVPAQEVKMVVPEDQSKKDGQPSDPNKLPSVEENKNLVSPAMREAPTSLSQLLDNSGA
PNVTIKPPGLTDLEVTPPVVSGEDLKKASVIPTLQDLSSSKEPSNSLNLPHSNELCSSLV
HPELSEVSSNVAPSIPPVMSRPVSSSSISTPLPPNQITVFVTSNPITTSANTSAALPTHL
QSALMSTVVTMPNAGSKVMVSEGQSAAQSNARPQFITPVFINSSSIIQVMKGSQPSTIPA
APLTTNSGLMPPSVAVVGPLHIPQNIKFSSAPVPPNALSSSPAPNIQTGRPLVLSSRATP
VQLPSPPCTSSPVVPSHPPVQQVKELNPDEASPQVNTSADQNTLPSSQSTTMVSPLLTNS
PGSSGNRRSPVSSSKGKGKVDKIGQILLTKACKKVTGSLEKGEEQYGADGETEGQGLDTT
APGLMGTEQLSTELDSKTPTPPAPTLLKMTSSPVGPGTASAGPSLPGGALPTSVRSIVTT
LVPSELISAVPTTKSNHGGIASESLAGGLVEEKVGSHPELLPSIAPSQNLVSKETSTTAL
QASVARPELEVNAAIVSGQSSEPKEIVEKSKIPGRRNSRTEEPTVASESVENGHRKRSSR
PASASSSTKDITSAVQSKRRKSK

Sequence length

2063

Interactions

View interactions

	Reactome
			RORA activates gene expression PPARA activates gene expression Transcriptional activation of mitochondrial biogenesis Activation of gene expression by SREBF (SREBP) Transcriptional regulation of white adipocyte differentiation Regulation of lipid metabolism by PPARalpha Circadian Clock

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (29)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
BILIARY TRACT CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CERVICAL CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIAL CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIOSIS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESOPHAGEAL CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESTROGEN-RECEPTOR NEGATIVE BREAST CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GALLSTONES	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GASTRIC CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GOUT	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEPATOCELLULAR CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG ADENOCARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MELANOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-HODGKINS LYMPHOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-MELANOMA SKIN CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN ENDOMETRIOID CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN SEROUS CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PANCREATIC CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL LUNG CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VENOUS THROMBOEMBOLISM	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (44)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenoma	Adenoma	BEFREE	26087193		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anorexia	Anorexia	BEFREE	31589911		★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	16343534		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	17236127		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	31531057, 8758910		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoma	Carcinoma	BEFREE	26087193		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	36086920	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Dilated	Cardiomyopathy	BEFREE	25131203		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	25131203		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	BEFREE	12446761		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	Pubtator	33339270	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	25793711		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	8986199		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital Heart Defects	Congenital heart defects	BEFREE	25131203		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	10232606, 9721855		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	GWASCAT_DG	29212778		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus	Diabetes mellitus	Pubtator	35477946	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrioma	Endometrioma	CTD_human_DG	22138541		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	CTD_human_DG	22138541		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gerstmann-Straussler-Scheinker Disease	Gerstmann-Straussler-Scheinker syndrome	BEFREE	1679288		★★★★★ ★☆☆☆☆ Found in Text Mining only
Growth Disorders	Growth disorder	Pubtator	32790097	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart Diseases	BEFREE	25131203		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	BEFREE	17236127		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	8986199		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	31531057, 8758910		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	UNIPROT_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	15561801		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	20957285, 9397195		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	10567404, 12368298		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	23613489		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	GWASDB_DG	18488026		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
melanoma	Melanoma	BEFREE	22628150, 24642353		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Melanoma	Pubtator	24642353, 25837821	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental disorders	Mental Disorders	BEFREE	17236127		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Retardation	Mental retardation	BEFREE	17236127		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10232606, 19219043, 19329434, 21116761, 26087193, 9721855		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephroblastoma	Nephroblastoma	BEFREE	21703850		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	24642353	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Posterior lenticonus	Posterior lenticonus	BEFREE	12446761		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	9397195		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	10232606, 9721855		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	6685980		★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin Diseases	Skin disease	Pubtator	35477946	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	36722273	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

NCOA6 (nuclear receptor coactivator 6)