Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	2305
Gene name	Forkhead box M1
Gene symbol	FOXM1
Synonyms (NCBI Gene)	FKHL16FOXM1AFOXM1BFOXM1CHFH-11HFH11HNF-3INS-1MPHOSPH2MPP-2MPP2PIG29TRIDENT
Chromosome	12
Chromosome location	12p13.33
Summary	The protein encoded by this gene is a transcriptional activator involved in cell proliferation. The encoded protein is phosphorylated in M phase and regulates the expression of several cell cycle genes, such as cyclin B1 and cyclin D1. Several transcript

238

Show/Hide all (238)

miRTarBase ID	miRNA	Experiments	Reference
MIRT006979	hsa-miR-134-5p	Luciferase reporter assayWestern blot	23010597
MIRT006979	hsa-miR-134-5p	Luciferase reporter assayWestern blot	23010597
MIRT030070	hsa-miR-26b-5p	Microarray	19088304
MIRT052645	hsa-miR-149-5p	Luciferase reporter assayWestern blot	23762558
MIRT052645	hsa-miR-149-5p	Luciferase reporter assayWestern blot	23762558
MIRT045084	hsa-miR-186-5p	CLASH	23622248
MIRT053073	hsa-miR-370-3p	Luciferase reporter assay	24055400
MIRT053073	hsa-miR-370-3p	Luciferase reporter assayqRT-PCRWestern blot	23576572
MIRT053766	hsa-miR-194-5p	ImmunofluorescenceqRT-PCRWestern blot	24748184
MIRT053073	hsa-miR-370-3p	Luciferase reporter assayWestern blot	22900969
MIRT053073	hsa-miR-370-3p	Luciferase reporter assayWestern blot	22900969
MIRT438246	hsa-miR-24-1-5p	5.0	24999187
MIRT438246	hsa-miR-24-1-5p	5.0	24999187
MIRT438246	hsa-miR-24-1-5p	5.0	24999187
MIRT438246	hsa-miR-24-1-5p	5.0	24999187
MIRT731505	hsa-miR-509-3-5p	Luciferase reporter assay	27035590
MIRT731505	hsa-miR-509-3-5p	Luciferase reporter assay	27035590
MIRT731927	hsa-miR-320a	Luciferase reporter assay	27086911
MIRT731927	hsa-miR-320a	Luciferase reporter assay	27086911
MIRT053073	hsa-miR-370-3p	Luciferase reporter assayqRT-PCRWestern blot	26617733
MIRT053073	hsa-miR-370-3p	Luciferase reporter assayqRT-PCRWestern blot	26617733
MIRT731927	hsa-miR-320a	ImmunohistochemistryLuciferase reporter assayqRT-PCRWestern blot	27086911
MIRT731927	hsa-miR-320a	ImmunohistochemistryLuciferase reporter assayqRT-PCRWestern blot	27086911
MIRT052645	hsa-miR-149-5p	Luciferase reporter assayqRT-PCRWestern blot	27415661
MIRT732579	hsa-miR-4521	Immunohistochemistry (IHC)Immunoprecipitaion (IP)Luciferase reporter assayqRT-PCRWestern blotting	33407516
MIRT732579	hsa-miR-4521	FACSImmunofluorescenceImmunohistochemistry (IHC)Luciferase reporter assayWestern blotting	31541075
MIRT734491	hsa-miR-552-3p	ChIP-seqImmunohistochemistry (IHC)In situ hybridizationLuciferase reporter assayqRT-PCRWestern blotting	33867818
MIRT735071	hsa-miR-21-3p	Luciferase reporter assayWestern blottingMicroarrayqRT-PCR	32782495
MIRT737073	hsa-miR-215-3p	Luciferase reporter assayqRT-PCRin vivo gain/loss-of-function experiments	31607224
MIRT737214	hsa-miR-4756-3p	Luciferase reporter assayWestern blottingqRT-PCR	31554904
MIRT737393	hsa-miR-1179	Luciferase reporter assayWestern blottingImmunoprecipitaion (IP)Immunohistochemistry (IHC)RNA-seqqRT-PCR	31951855
MIRT737413	hsa-miR-134-3p	Luciferase reporter assayWestern blottingqRT-PCR	31934035
MIRT755522	hsa-miR-637	Luciferase reporter assayWestern blottingqRT-PCR	34519627
MIRT755696	hsa-miR-320b	Luciferase reporter assayWestern blottingNorthern blottingqRT-PCRin vitro cullelar assaysIn situ hybridizationRNA pull down assay	33782807
MIRT755850	hsa-miR-325-3P	Luciferase reporter assayWestern blottingqRT-PCR	34997725
MIRT1002482	hsa-miR-1224-3p	CLIP-seq
MIRT1002483	hsa-miR-1237	CLIP-seq
MIRT1002484	hsa-miR-1261	CLIP-seq
MIRT1002485	hsa-miR-3128	CLIP-seq
MIRT1002486	hsa-miR-326	CLIP-seq
MIRT1002487	hsa-miR-330-5p	CLIP-seq
MIRT1002488	hsa-miR-34a	CLIP-seq
MIRT1002489	hsa-miR-34c-5p	CLIP-seq
MIRT1002490	hsa-miR-449a	CLIP-seq
MIRT1002491	hsa-miR-449b	CLIP-seq
MIRT1002492	hsa-miR-4720-5p	CLIP-seq
MIRT1002493	hsa-miR-4726-3p	CLIP-seq
MIRT1002494	hsa-miR-4782-5p	CLIP-seq
MIRT1002495	hsa-miR-4793-5p	CLIP-seq
MIRT1002496	hsa-miR-4799-3p	CLIP-seq
MIRT1002497	hsa-miR-593	CLIP-seq
MIRT1002498	hsa-miR-1185	CLIP-seq
MIRT1002499	hsa-miR-1270	CLIP-seq
MIRT1002500	hsa-miR-3125	CLIP-seq
MIRT1002501	hsa-miR-3167	CLIP-seq
MIRT1002502	hsa-miR-323b-3p	CLIP-seq
MIRT1002503	hsa-miR-3620	CLIP-seq
MIRT1002504	hsa-miR-3679-5p	CLIP-seq
MIRT1002505	hsa-miR-3916	CLIP-seq
MIRT1002506	hsa-miR-4434	CLIP-seq
MIRT1002507	hsa-miR-4516	CLIP-seq
MIRT1002508	hsa-miR-4531	CLIP-seq
MIRT1002509	hsa-miR-4659a-3p	CLIP-seq
MIRT1002510	hsa-miR-4659b-3p	CLIP-seq
MIRT1002511	hsa-miR-4699-3p	CLIP-seq
MIRT1002512	hsa-miR-4778-3p	CLIP-seq
MIRT1002513	hsa-miR-518a-5p	CLIP-seq
MIRT1002514	hsa-miR-527	CLIP-seq
MIRT1002515	hsa-miR-548u	CLIP-seq
MIRT1002516	hsa-miR-602	CLIP-seq
MIRT1002517	hsa-miR-620	CLIP-seq
MIRT1002518	hsa-miR-876-5p	CLIP-seq
MIRT1002519	hsa-miR-877	CLIP-seq
MIRT1997136	hsa-miR-1193	CLIP-seq
MIRT1997137	hsa-miR-1207-3p	CLIP-seq
MIRT1002482	hsa-miR-1224-3p	CLIP-seq
MIRT1002483	hsa-miR-1237	CLIP-seq
MIRT1997138	hsa-miR-1260	CLIP-seq
MIRT1997139	hsa-miR-1260b	CLIP-seq
MIRT1002484	hsa-miR-1261	CLIP-seq
MIRT1997140	hsa-miR-1280	CLIP-seq
MIRT1997141	hsa-miR-1285	CLIP-seq
MIRT1997142	hsa-miR-132	CLIP-seq
MIRT1997143	hsa-miR-153	CLIP-seq
MIRT1997144	hsa-miR-2114	CLIP-seq
MIRT1997145	hsa-miR-212	CLIP-seq
MIRT1997146	hsa-miR-214	CLIP-seq
MIRT1002485	hsa-miR-3128	CLIP-seq
MIRT1997147	hsa-miR-3135	CLIP-seq
MIRT1997148	hsa-miR-3138	CLIP-seq
MIRT1997149	hsa-miR-3150b-3p	CLIP-seq
MIRT1997150	hsa-miR-3165	CLIP-seq
MIRT1997151	hsa-miR-3170	CLIP-seq
MIRT1997152	hsa-miR-3184	CLIP-seq
MIRT1997153	hsa-miR-3187-5p	CLIP-seq
MIRT1997154	hsa-miR-3188	CLIP-seq
MIRT755696	hsa-miR-320b	CLIP-seq
MIRT1997155	hsa-miR-320c	CLIP-seq
MIRT1997156	hsa-miR-320d	CLIP-seq
MIRT1997157	hsa-miR-324-5p	CLIP-seq
MIRT1002486	hsa-miR-326	CLIP-seq
MIRT1002487	hsa-miR-330-5p	CLIP-seq
MIRT1997158	hsa-miR-342-5p	CLIP-seq
MIRT1002488	hsa-miR-34a	CLIP-seq
MIRT1002489	hsa-miR-34c-5p	CLIP-seq
MIRT1997159	hsa-miR-3619-5p	CLIP-seq
MIRT1997160	hsa-miR-370	CLIP-seq
MIRT1997161	hsa-miR-371b-3p	CLIP-seq
MIRT1997162	hsa-miR-378g	CLIP-seq
MIRT1997163	hsa-miR-3909	CLIP-seq
MIRT1997164	hsa-miR-3977	CLIP-seq
MIRT1997165	hsa-miR-423-5p	CLIP-seq
MIRT1997166	hsa-miR-4257	CLIP-seq
MIRT1997167	hsa-miR-4269	CLIP-seq
MIRT1997168	hsa-miR-4270	CLIP-seq
MIRT1997169	hsa-miR-4272	CLIP-seq
MIRT1997170	hsa-miR-4300	CLIP-seq
MIRT1997171	hsa-miR-4317	CLIP-seq
MIRT1997172	hsa-miR-4429	CLIP-seq
MIRT1997173	hsa-miR-4441	CLIP-seq
MIRT1997174	hsa-miR-4468	CLIP-seq
MIRT1997175	hsa-miR-448	CLIP-seq
MIRT1997176	hsa-miR-4486	CLIP-seq
MIRT1002490	hsa-miR-449a	CLIP-seq
MIRT1002491	hsa-miR-449b	CLIP-seq
MIRT1997177	hsa-miR-450b-5p	CLIP-seq
MIRT1997178	hsa-miR-4514	CLIP-seq
MIRT1997179	hsa-miR-4520a-3p	CLIP-seq
MIRT1997180	hsa-miR-4633-3p	CLIP-seq
MIRT1997181	hsa-miR-4645-5p	CLIP-seq
MIRT1997182	hsa-miR-4651	CLIP-seq
MIRT1997183	hsa-miR-4664-5p	CLIP-seq
MIRT1997184	hsa-miR-4673	CLIP-seq
MIRT1997185	hsa-miR-4688	CLIP-seq
MIRT1997186	hsa-miR-4689	CLIP-seq
MIRT1997187	hsa-miR-4692	CLIP-seq
MIRT1002511	hsa-miR-4699-3p	CLIP-seq
MIRT1002492	hsa-miR-4720-5p	CLIP-seq
MIRT1002493	hsa-miR-4726-3p	CLIP-seq
MIRT1997188	hsa-miR-4731-5p	CLIP-seq
MIRT1997189	hsa-miR-4736	CLIP-seq
MIRT1997190	hsa-miR-4742-5p	CLIP-seq
MIRT1997191	hsa-miR-4747-5p	CLIP-seq
MIRT1997192	hsa-miR-4755-3p	CLIP-seq
MIRT1997193	hsa-miR-4763-5p	CLIP-seq
MIRT1997194	hsa-miR-4772-5p	CLIP-seq
MIRT1997195	hsa-miR-4773	CLIP-seq
MIRT1997196	hsa-miR-4777-3p	CLIP-seq
MIRT1002494	hsa-miR-4782-5p	CLIP-seq
MIRT1997197	hsa-miR-4784	CLIP-seq
MIRT1997198	hsa-miR-4786-3p	CLIP-seq
MIRT1002495	hsa-miR-4793-5p	CLIP-seq
MIRT1002496	hsa-miR-4799-3p	CLIP-seq
MIRT1997199	hsa-miR-507	CLIP-seq
MIRT1002513	hsa-miR-518a-5p	CLIP-seq
MIRT1002514	hsa-miR-527	CLIP-seq
MIRT1997200	hsa-miR-532-3p	CLIP-seq
MIRT1997201	hsa-miR-548ag	CLIP-seq
MIRT1997202	hsa-miR-548ai	CLIP-seq
MIRT1997203	hsa-miR-557	CLIP-seq
MIRT1002497	hsa-miR-593	CLIP-seq
MIRT1997204	hsa-miR-608	CLIP-seq
MIRT1997205	hsa-miR-612	CLIP-seq
MIRT1997206	hsa-miR-626	CLIP-seq
MIRT1997207	hsa-miR-760	CLIP-seq
MIRT1997208	hsa-miR-761	CLIP-seq
MIRT1997209	hsa-miR-920	CLIP-seq
MIRT1997210	hsa-miR-940	CLIP-seq
MIRT2230953	hsa-miR-1207-5p	CLIP-seq
MIRT1002482	hsa-miR-1224-3p	CLIP-seq
MIRT1997138	hsa-miR-1260	CLIP-seq
MIRT1997139	hsa-miR-1260b	CLIP-seq
MIRT1997140	hsa-miR-1280	CLIP-seq
MIRT1997142	hsa-miR-132	CLIP-seq
MIRT2230954	hsa-miR-1321	CLIP-seq
MIRT1997143	hsa-miR-153	CLIP-seq
MIRT1997144	hsa-miR-2114	CLIP-seq
MIRT1997145	hsa-miR-212	CLIP-seq
MIRT1002500	hsa-miR-3125	CLIP-seq
MIRT1997149	hsa-miR-3150b-3p	CLIP-seq
MIRT1997152	hsa-miR-3184	CLIP-seq
MIRT755696	hsa-miR-320b	CLIP-seq
MIRT1997155	hsa-miR-320c	CLIP-seq
MIRT1997156	hsa-miR-320d	CLIP-seq
MIRT1002502	hsa-miR-323b-3p	CLIP-seq
MIRT1997157	hsa-miR-324-5p	CLIP-seq
MIRT2230955	hsa-miR-361-5p	CLIP-seq
MIRT2230956	hsa-miR-3689d	CLIP-seq
MIRT1997160	hsa-miR-370	CLIP-seq
MIRT1997163	hsa-miR-3909	CLIP-seq
MIRT1002505	hsa-miR-3916	CLIP-seq
MIRT2230957	hsa-miR-3919	CLIP-seq
MIRT1997165	hsa-miR-423-5p	CLIP-seq
MIRT2230958	hsa-miR-4261	CLIP-seq
MIRT1997167	hsa-miR-4269	CLIP-seq
MIRT1997168	hsa-miR-4270	CLIP-seq
MIRT1997172	hsa-miR-4429	CLIP-seq
MIRT1997173	hsa-miR-4441	CLIP-seq
MIRT1997175	hsa-miR-448	CLIP-seq
MIRT1997177	hsa-miR-450b-5p	CLIP-seq
MIRT1997178	hsa-miR-4514	CLIP-seq
MIRT1997181	hsa-miR-4645-5p	CLIP-seq
MIRT1997184	hsa-miR-4673	CLIP-seq
MIRT1997185	hsa-miR-4688	CLIP-seq
MIRT1997186	hsa-miR-4689	CLIP-seq
MIRT1997187	hsa-miR-4692	CLIP-seq
MIRT2230959	hsa-miR-4728-5p	CLIP-seq
MIRT1997189	hsa-miR-4736	CLIP-seq
MIRT2230960	hsa-miR-4739	CLIP-seq
MIRT1997190	hsa-miR-4742-5p	CLIP-seq
MIRT1997192	hsa-miR-4755-3p	CLIP-seq
MIRT2230961	hsa-miR-4756-5p	CLIP-seq
MIRT2230962	hsa-miR-4763-3p	CLIP-seq
MIRT1997193	hsa-miR-4763-5p	CLIP-seq
MIRT1997195	hsa-miR-4773	CLIP-seq
MIRT2230963	hsa-miR-4774-5p	CLIP-seq
MIRT1997197	hsa-miR-4784	CLIP-seq
MIRT1997198	hsa-miR-4786-3p	CLIP-seq
MIRT2230964	hsa-miR-494	CLIP-seq
MIRT1997199	hsa-miR-507	CLIP-seq
MIRT1002513	hsa-miR-518a-5p	CLIP-seq
MIRT1002514	hsa-miR-527	CLIP-seq
MIRT1997200	hsa-miR-532-3p	CLIP-seq
MIRT1997203	hsa-miR-557	CLIP-seq
MIRT1002516	hsa-miR-602	CLIP-seq
MIRT1997206	hsa-miR-626	CLIP-seq
MIRT1997210	hsa-miR-940	CLIP-seq
MIRT1997152	hsa-miR-3184	CLIP-seq
MIRT755696	hsa-miR-320b	CLIP-seq
MIRT1997155	hsa-miR-320c	CLIP-seq
MIRT1997156	hsa-miR-320d	CLIP-seq
MIRT1997165	hsa-miR-423-5p	CLIP-seq
MIRT1997172	hsa-miR-4429	CLIP-seq
MIRT1997177	hsa-miR-450b-5p	CLIP-seq
MIRT1997185	hsa-miR-4688	CLIP-seq
MIRT1002513	hsa-miR-518a-5p	CLIP-seq
MIRT1002514	hsa-miR-527	CLIP-seq
MIRT1997207	hsa-miR-760	CLIP-seq

Show/Hide all (7)

Transcription factor	Regulation	Reference
ATM	Activation	21518729
E2F1	Activation	21518729
FLI1	Activation	23365673
FOXO3	Repression	19276163
MYC	Activation	20658516
SP1	Activation	20372080
TP53	Repression	21518729

Show/Hide all (38)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000086	Process	G2/M transition of mitotic cell cycle	IDA	19160488
GO:0000086	Process	G2/M transition of mitotic cell cycle	IEA
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IMP	20531406
GO:0000785	Component	Chromatin	ISA
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IBA
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IDA	21860419
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0003677	Function	DNA binding	IDA	9032290
GO:0003677	Function	DNA binding	IEA
GO:0003677	Function	DNA binding	TAS	9242644
GO:0003700	Function	DNA-binding transcription factor activity	IDA	9032290, 10523841
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0003700	Function	DNA-binding transcription factor activity	TAS	9441747
GO:0005515	Function	Protein binding	IPI	10523841, 16504183, 16809346, 22014570, 22094256, 25609649, 26871637, 31134895, 33754036
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0006281	Process	DNA repair	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0006974	Process	DNA damage response	IEA
GO:0007346	Process	Regulation of mitotic cell cycle	IDA	19160488
GO:0008284	Process	Positive regulation of cell population proliferation	IMP	19696738
GO:0019901	Function	Protein kinase binding	IPI	19160488
GO:0030330	Process	DNA damage response, signal transduction by p53 class mediator	IMP	17101782
GO:0032873	Process	Negative regulation of stress-activated MAPK cascade	IMP	19696738
GO:0042127	Process	Regulation of cell population proliferation	IBA
GO:0042127	Process	Regulation of cell population proliferation	NAS	9441747
GO:0043565	Function	Sequence-specific DNA binding	IEA
GO:0045892	Process	Negative regulation of DNA-templated transcription	IMP	20531406
GO:0045893	Process	Positive regulation of DNA-templated transcription	IDA	9032290, 10523841
GO:0045893	Process	Positive regulation of DNA-templated transcription	IMP	17101782, 20531406
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	19160488
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IMP	20531406
GO:0046578	Process	Regulation of Ras protein signal transduction	IMP	19696738
GO:0051726	Process	Regulation of cell cycle	IMP	19696738
GO:2000377	Process	Regulation of reactive oxygen species metabolic process	IMP	19696738
GO:2000781	Process	Positive regulation of double-strand break repair	IMP	17101782

MIM	HGNC	e!Ensembl
602341	3818	ENSG00000111206

Q08050

Protein name

Forkhead box protein M1 (Forkhead-related protein FKHL16) (Hepatocyte nuclear factor 3 forkhead homolog 11) (HFH-11) (HNF-3/fork-head homolog 11) (M-phase phosphoprotein 2) (MPM-2 reactive phosphoprotein 2) (Transcription factor Trident) (Winged-helix fac

Protein function

Transcription factor regulating the expression of cell cycle genes essential for DNA replication and mitosis (PubMed:19160488, PubMed:20360045). Plays a role in the control of cell proliferation (PubMed:19160488). Also plays a role in DNA break

PDB

3G73 , 7FJ2

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00250	Forkhead	235 → 319	Forkhead domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in thymus, testis, small intestine, colon followed by ovary. Appears to be expressed only in adult organs containing proliferating/cycling cells or in response to growth factors. Also expressed in epithelial cell lines derive

Sequence

MKTSPRRPLILKRRRLPLPVQNAPSETSEEEPKRSPAQQESNQAEASKEVAESNSCKFPA
GIKIINHPTMPNTQVVAIPNNANIHSIITALTAKGKESGSSGPNKFILISCGGAPTQPPG
LRPQTQTSYDAKRTEVTLETLGPKPAARDVNLPRPPGALCEQKRETCADGEAAGCTINNS
LSNIQWLRKMSSDGLGSRSIKQEMEEKENCHLEQRQVKVEEPSRPSASWQNSVSERPPYS
YMAMIQFAINSTERKRMTLKDIYTWIEDHFPYFKHIAKPGWKNSIRHNLSLHDMFVRETS
ANGKVSFWTIHPSANRYLTLDQVFKPLDPGSPQLPEHLESQQKRPNPELRRNMTIKTELP
LGARRKMKPLLPRVSSYLVPIQFPVNQSLVLQPSVKVPLPLAASLMSSELARHSKRVRIA
PKVLLAEEGIAPLSSAGPGKEEKLLFGEGFSPLLPVQTIKEEEIQPGEEMPHLARPIKVE
SPPLEEWPSPAPSFKEESSHSWEDSSQSPTPRPKKSYSGLRSPTRCVSEMLVIQHRERRE
RSRSRRKQHLLPPCVDEPELLFSEGPSTSRWAAELPFPADSSDPASQLSYSQEVGGPFKT
PIKETLPISSTPSKSVLPRTPESWRLTPPAKVGGLDFSPVQTSQGASDPLPDPLGLMDLS
TTPLQSAPPLESPQRLLSSEPLDLISVPFGNSSPSDIDVPKPGSPEPQVSGLAANRSLTE
GLVLDTMNDSLSKILLDISFPGLDEDPLGPDNINWSQFIPELQ

Sequence length

763

Interactions

View interactions

	KEGG		Reactome
	Cellular senescence		Polo-like kinase mediated events Cyclin A/B1/B2 associated events during G2/M transition

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (8)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
BREAST NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, HEPATOCELLULAR	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, NON-SMALL-CELL LUNG	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IGA GLOMERULONEPHRITIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEUKEMIA	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER NEOPLASMS, EXPERIMENTAL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UPPER AERODIGESTIVE TRACT NEOPLASM	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (327)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute leukemia	Leukemia	BEFREE	25310131		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	25753524		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Undifferentiated Leukemia	Leukemia	BEFREE	28401599		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	16452231, 16701100, 23037713, 26563366, 28423516, 29267283		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	LHGDN	16701100		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma Of Esophagus	Esophageal Cancer	BEFREE	23037713, 25889361		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of large intestine	Colorectal Cancer	BEFREE	30278464		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	22447226, 23255470, 23271813, 25561901, 27494877, 27521795, 31085008, 31115500, 31198635, 31545403		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	29267283		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenal Cortical Adenoma	Adrenocortical adenoma	BEFREE	31783819		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenal Gland Pheochromocytoma	Adrenal Gland Pheochromocytoma	BEFREE	11152283, 30367545		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenocortical carcinoma	Adrenocortical carcinoma	BEFREE	31783819		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenocortical Carcinoma	Adrenocortical carcinoma	Pubtator	31783819	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Diffuse Large B-Cell Lymphoma	B-cell Lymphoma	BEFREE	22271891		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Malignant Peripheral Nerve Sheath Tumor	Malignant Peripheral Nerve Sheath Tumor	BEFREE	21325289		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	21918172, 23912794, 29344238, 31541075		★★★★★ ★☆☆☆☆ Found in Text Mining only
Agenesis of corpus callosum	Agenesis Of Corpus Callosum	BEFREE	31325906, 31783819		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aicardi Syndrome	Aicardi syndrome	Pubtator	31783819	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anaplastic astrocytoma	Anaplastic Astrocytoma	BEFREE	16489016, 16585184		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anaplastic Large Cell Lymphoma, ALK-Positive	Anaplastic Lymphoma	BEFREE	31390744		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anaplastic thyroid carcinoma	Anaplastic thyroid cancer	BEFREE	22919068, 29306020, 31183379		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aneuploidy	Aneuploidy	Pubtator	30026603	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	28807830, 30705403, 31025257		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aplasia Cutis Congenita	Aplasia Cutis Congenita	BEFREE	31325906, 31783819		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	29950315		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	24211233, 31740799		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	31854447	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis, Psoriatic	Psoriatic Arthritis	BEFREE	31737170		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	29158087, 29999407		★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	12937144, 36115056	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	29950315		★★★★★ ★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	22049175, 29512768, 30405826		★★★★★ ★☆☆☆☆ Found in Text Mining only
Benign Neoplasm	Benign Neoplasm	BEFREE	20386868		★★★★★ ★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	24676803		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	23325617, 24999187, 28498805, 29397866, 29511457, 30242024, 30277841, 30414902		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	15958562, 18254960, 18645012, 19276163, 19513552, 19813088, 20068070, 20190804, 20208560, 20530690, 21154750, 21518729, 21707964, 22203467, 22581827 View all (37 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	CTD_human_DG	20208560		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	16809346, 18645012, 19276163, 19596828, 20068070, 20208560, 20530690, 21225456, 21860419, 23318431, 23347430, 24362530, 24866763, 24896091, 25213081 View all (27 more)	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	18254960	Stimulate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	23372748	Inhibit	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms Male	Male breast neoplasms	Pubtator	29504520	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchopulmonary Dysplasia	Bronchopulmonary Dysplasia	BEFREE	25275225		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	21858223, 23006512, 23325617, 24362530, 25213081, 25897210, 26080399, 27167337, 28148279, 28358012, 28498805, 29303511, 30060118, 32035486, 32514270, 37288663, 37401400 View all (2 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	16452231, 17014965, 17018632, 17804744, 21154750, 22359343, 23306612, 23325617, 23856032, 24577129, 25201015, 26370421, 26884854		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	Pubtator	22271891	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	20187950	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	20154714, 22930530, 25574092, 27383303, 29303511, 29658607, 31886176, 32174012, 32390596, 34087888, 35761036, 35812416, 35887129, 35955438, 37234166, 39596041 View all (1 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	28849004, 34810266, 35013529, 38001498	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma in Situ	Carcinoma in situ	Pubtator	26415052	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	23325617, 24999187, 28498805, 29397866, 29511457, 30242024, 30277841, 30414902		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	16489016, 20816795, 23177020, 23271813, 24715097, 25936405, 29552057, 29704495, 30111255, 31115500, 31208440, 31602275		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of Male Breast	Breast Carcinoma, male	BEFREE	28376490		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	24885308, 28482906	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	34117362	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	23006512, 25579557, 28902136, 29700419, 31422942, 31625200, 31743108, 32249812, 33968297, 34212534	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	19287496, 27385468, 27409343, 32514270, 37957720	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Basal Cell	Carcinoma	BEFREE	12183437, 15492844, 15958562		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	22589409, 24604117, 24673814, 25411964, 26243836, 26877780, 27167337, 27351131, 27593933, 28482906, 28498253, 28692634, 29423068, 30129654, 30236833		★★★★★ ★☆☆☆☆ Found in Text Mining only
CARDIOMYOPATHY, FAMILIAL RESTRICTIVE, 1 (disorder)	Cardiomyopathy	BEFREE	31040162		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	31042405		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	37681487	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	29735255		★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	18464245, 24141769, 25066298, 25201015, 26820938, 28861147, 28927151, 29432282, 30856345, 31699366		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervical Intraepithelial Neoplasia	Cervical Intraepithelial Neoplasia	BEFREE	18464245		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	18464245, 24141769, 25066298, 25201015, 26563366, 26820938, 28861147, 28927151, 29432282, 30856345, 31699366		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Malignant Peripheral Nerve Sheath Tumor	Malignant Peripheral Nerve Sheath Tumor	BEFREE	21325289		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	21918172, 23912794, 29344238, 31541075		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	19688828, 25897210, 30538221		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	25897210, 30538221	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chromosomal Instability	Chromosomal instability	Pubtator	37452072	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	25482129		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	17408638, 23136192, 25446103, 26091938, 30628173, 30744076		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	30278464, 34790819	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	17408638, 21281787, 22326401, 25613903, 25935853, 26159723, 26264222, 26370421, 27034162, 27119506, 27162244, 27399334, 27401611, 27415661, 28051999 View all (15 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	BEFREE	17408638		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	20372080, 25613903, 26264222, 26350748, 27034162, 27415661, 28148279, 29301438, 30728402, 30941959, 33214609, 33291076, 34262080, 34337040, 36591565	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	25935853	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital chromosomal disease	Congenital Chromosomal Disease	BEFREE	29121006		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital contractural arachnodactyly	Congenital Contractural Arachnodactyly	BEFREE	25897210, 29464042, 30538221		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	27601681		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	23006512, 28902136, 29792186, 30609136, 31743108, 31767633		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	30511802		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	30511802, 31202960		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	30511802		★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	30015893	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	23241445, 27082728, 30612087		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	25391656, 28286049, 31202960		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Complications	Diabetes complications	Pubtator	37681487	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	35779916	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	10899756, 25391656, 28286049, 31202960		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	22413961, 35856334, 37681487	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	33633681	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	16390390, 31720731, 7673396		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	10899756		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Foot	Diabetic foot	Pubtator	35856334	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	22271891, 23022474, 24130802		★★★★★ ★☆☆☆☆ Found in Text Mining only
EAR, PATELLA, SHORT STATURE SYNDROME	Ear Diseases	BEFREE	30445139		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	29190956		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	26193427, 33503056, 37159818, 38646803	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	29308746, 31039568		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsies Myoclonic	Myoclonic epilepsy	Pubtator	31445158	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
EPILEPTIC ENCEPHALOPATHY, EARLY INFANTILE, 2	Epileptic encephalopathy	BEFREE	31445158		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	24673814, 26243836, 27351131, 28482906, 28498253, 28692634, 29423068		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	26722467		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	26722467		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	26722467, 30485581, 32035486	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	21976009, 29877046, 30485581, 34117362, 35639418, 35842667	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
ESTROGEN RESISTANCE	Estrogen Resistance	BEFREE	20208560		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ewings sarcoma	Ewing sarcoma	BEFREE	23365673, 23857410		★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial Primary Pulmonary Hypertension	Pulmonary hypertension	Pubtator	25290246	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	21204266		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gallbladder Carcinoma	Gallbladder cancer	BEFREE	25071344, 27716361		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gallbladder Neoplasms	Gallbladder neoplasm	Pubtator	25071344	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastric Adenocarcinoma	Gastric Cancer	BEFREE	31574259		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Diseases	Gastrointestinal disease	Pubtator	25797272	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	BEFREE	29948390		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	Pubtator	36833422	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma Open Angle	Open angle glaucoma	Pubtator	36833422	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	12937144, 20419098, 22977194, 26085085, 27764801, 28399407, 29039578, 35039475, 38069906, 40725039	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	16489016, 16585184, 17404569, 18974115, 22977194, 25601206, 25832656, 26040766, 26085085, 26444992, 27764801, 28399407, 28784180, 29039578, 29700308, 30167084, 30909436, 31272759 View all (3 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	LHGDN	16585184		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	16585184, 17404569, 18974115, 20332230, 22977194, 25506897, 25601206, 25832656, 26040766, 26085085, 26444992, 27764801, 28399407, 28784180, 29039578 View all (5 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	12183437, 16585184, 17404569, 18974115, 20332230, 23404835, 23991102, 24488909, 26085085, 26342429, 27852048, 28731180, 28767320, 28784180, 29704495, 30730955, 31434700, 31796105 View all (3 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	LHGDN	16585184		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	23991102, 26085085, 27852048, 28767320, 28784180, 30730955, 34252882, 35013529, 36564758	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	24488909	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Graves Ophthalmopathy	Graves ophthalmopathy	Pubtator	37272763	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	33160365, 35313071	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	36118675	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	27601681		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	36795481	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	20187950	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary hemochromatosis	Hereditary Hemochromatosis	BEFREE	19200615		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Leiomyomatosis and Renal Cell Cancer	Hereditary Leiomyomatosis and Renal Cancer	BEFREE	28289076		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	28220272, 28768836		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperplasia	Hyperplasia	Pubtator	22461910, 23775078, 31437238	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	29664678		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	22033266, 31364741, 34181359	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	38190128	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	29290032, 29664678, 30092353, 30992007, 31042405, 31190319, 31437238		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	29789556		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	29789556, 37653539	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary hypertension	Pulmonary Hypertension	BEFREE	30092353		★★★★★ ★☆☆☆☆ Found in Text Mining only
IGA Glomerulonephritis	Glomerulonephritis	CTD_human_DG	25133636		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Impaired cognition	Impaired Cognition	BEFREE	31526770		★★★★★ ★☆☆☆☆ Found in Text Mining only
Infantile Severe Myoclonic Epilepsy	Myoclonic Epilepsy	BEFREE	31445158		★★★★★ ★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	37681487	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
insulinoma	Insulinoma	BEFREE	11024034, 17685585, 18775714, 20872723, 23860123, 25248790, 28478482, 29225069, 29225191, 29541192, 30557852, 31787713, 9242644, 9576743		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intestinal Cancer	Intestinal Cancer	BEFREE	23136192		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholangiocarcinoma	Intrahepatic Cholangiocarcinoma	BEFREE	30580327		★★★★★ ★☆☆☆☆ Found in Text Mining only
Invasive Ductal Breast Carcinoma	Invasive Duct and Lobular Carcinoma	BEFREE	26404623		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ischemic cardiomyopathy	Ischemic myocardial dysfunction	BEFREE	28923793		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	37681487	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	15082532		★★★★★ ★☆☆☆☆ Found in Text Mining only
Laryngeal Neoplasms	Laryngeal neoplasm	Pubtator	32633370	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Laryngeal Squamous Cell Carcinoma	Laryngeal Carcinoma	BEFREE	21334713, 24055400		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leiomyosarcoma	Leiomyosarcoma	Pubtator	26560505	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	CTD_human_DG	19436953		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Leukemia	Leukemia	Pubtator	23110199, 26316295, 31122263	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
leukemia	Leukemia	BEFREE	25175498, 25310131		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	22900969, 34711181	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	36481766	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	20823107, 22900969, 24582753, 25179295, 30089730		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	1324404, 15082532, 15661532, 15958562, 16489016, 18393292, 20154714, 20159939, 21204266, 21482449, 21712406, 22613004, 22831955, 23262037, 23812424 View all (32 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	CTD_human_DG	15082532, 17173139, 28284560		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	1324404, 15082532, 16452231, 22613004, 29705704		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	BEFREE	30992007		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	16489016, 18345025, 20816795, 23271813, 24213573, 29267283, 30499104		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung Neoplasms	CTD_human_DG	16489016, 23255470		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung neoplasms	Pubtator	23167412, 23271813, 30111255, 33099911, 35756697, 36435510, 37236507, 38296976	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	33633721	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	21858223, 23006512, 23167412, 29360662	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	23536876, 24885308, 25231007, 25829806, 25935853, 28848994	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma Follicular	Lymphoma	Pubtator	26589882	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	21305641		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	16585184, 23991102, 26342429, 31796105		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant mesothelioma	Malignant Mesothelioma	BEFREE	22286761, 23018647		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of brain	Brain Neoplasms	BEFREE	25017123		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	15958562, 18254960, 18645012, 19276163, 19513552, 19813088, 20068070, 20190804, 20208560, 20530690, 21154750, 21518729, 21707964, 22203467, 22581827 View all (41 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	CTD_human_DG	20208560		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	29190956		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	26722467, 30485581		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gallbladder	Gallbladder cancer	BEFREE	27716361		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gastrointestinal tract	Malignant gastrointestinal tract tumors	BEFREE	28440206		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	30066895		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	25828473, 28012972, 28249813, 30814128, 31580537		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	16489016, 18345025, 20816795, 23177020, 23271813, 24715097, 25425970, 25936405, 29552057, 29704495, 30111255, 31115500, 31208440, 31602275		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	CTD_human_DG	16489016, 23255470		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of oropharynx	Malignant Neoplasm Of Oropharynx	BEFREE	29443638		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	22589409, 24604117, 25411964, 26877780, 27167337, 27593933, 30129654, 30236833		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	15492844, 17804744, 20354770, 21503965, 22194465, 23598278, 24418574, 24479803, 24634381, 28258481, 30352219, 30367545, 30538111, 30628173, 30705403, 30782607, 31334335, 31598398 View all (3 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	15753356, 16452231, 21606178, 24583551, 24676803, 24823640, 25254494, 27108958, 27213551, 27324222, 28199985, 28677763, 29313393, 29554906, 30719174, 30996073, 31364741 View all (2 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of skin	Skin cancer	BEFREE	20187950		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	19235838, 19351851, 24004449, 24628949, 24715000, 24726291, 25633416, 26164001, 26261559, 26451068, 27086911, 27185371, 27455555, 28078605, 28276310 View all (12 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	22919068		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	23325617, 24999187, 28498805, 29397866, 29511457, 30242024, 30277841, 30414902		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	12183437, 17014965, 18464245, 18645012, 19235838, 19287496, 19351851, 19688828, 19696738, 20068070, 20187950, 20190804, 20400365, 21270518, 21281787 View all (102 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Peripheral Nerve Sheath Tumor	Malignant Peripheral Nerve Sheath Tumor	BEFREE	21325289		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	18464245, 24141769, 25066298, 25201015, 26820938, 28861147, 28927151, 29432282, 30856345, 31699366		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	17408638, 23136192, 25446103, 26091938, 30628173, 30744076		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Carcinoma, Human	Marfan Syndrome	CTD_human_DG	20208560		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	15958562		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	18254960, 23665201, 27378691, 29416660		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	CTD_human_DG	20208560		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms, Human	Mammary Neoplasms	CTD_human_DG	20208560		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	21918172, 23912794, 29344238, 31541075		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	Pubtator	31541075	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	26279295, 26640950, 27389544, 28225180, 30910803		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	26279295	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	26640950, 30910803, 35138218	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	Pubtator	28195122, 36115056	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	BEFREE	29590631, 31179553		★★★★★ ★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	Pubtator	29590631, 33099292, 35570314, 36227281	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	Pubtator	34859258	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	19218339	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	22761781, 23018647, 34859258	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	10899756		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metastatic melanoma	Metastatic Melanoma	BEFREE	20658516, 26279295, 26640950		★★★★★ ★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	BEFREE	31330139		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth Neoplasms	BEFREE	29443638		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	37641028	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mucinous Adenocarcinoma	Mucinous Adenocarcinoma	BEFREE	29267283		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	26648534, 28835615, 30463534		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	28835615, 35015835	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	26147687		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	36481766	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	28401599, 31122263		★★★★★ ★☆☆☆☆ Found in Text Mining only
MYELOPROLIFERATIVE SYNDROME, TRANSIENT	Myeloproliferative disorder	BEFREE	26451068		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	28011860, 30552062		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myopia	Myopia	Pubtator	38190128	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	22359343, 25337187, 25738652, 25986250, 28277541, 30416986, 30638177		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	25231007, 28277541, 35656815	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	25337187, 30638177	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Necrosis	Necrosis	Pubtator	29343703	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neonatal diabetes mellitus	Diabetes Mellitus	BEFREE	17065345		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	15082532, 15661532, 16452231, 18464245, 19200615, 19351851, 19696738, 20332230, 21154750, 21281787, 21979956, 22049175, 22109759, 22203467, 22271891 View all (94 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms, Intracranial	Intracranial Neoplasm	BEFREE	23404835		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nervous System Diseases	Nervous system disease	Pubtator	37681487	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	31675181		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	21507930, 30504901, 31164657		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	30451831, 35428820	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroendocrine Tumors	Neuroendocrine Tumors	BEFREE	25797272, 28910819		★★★★★ ★☆☆☆☆ Found in Text Mining only
Niemann-Pick Disease, Type C	Niemann-Pick Disease	BEFREE	30638177		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	CTD_human_DG	18345025, 19672312		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	19200615, 22447226, 23177020, 23536876, 24213573, 24715097, 25700356, 25808837, 25936405, 26451068, 27035590, 27521795, 28542137, 28850563, 29130108 View all (12 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	20660304, 31292722		★★★★★ ★☆☆☆☆ Found in Text Mining only
Oestrogen receptor positive breast cancer	Oestrogen Receptor Positive Breast Cancer	BEFREE	16809346, 23347430, 26456572, 27378691, 28579430		★★★★★ ★☆☆☆☆ Found in Text Mining only
Oropharyngeal Carcinoma	Oropharyngeal Carcinoma	BEFREE	29443638		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	33297736, 38218927	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteogenesis imperfecta type 2A	Osteogenesis imperfecta	Pubtator	29877046	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	15082532, 16314512, 24282087, 24795528, 26617733, 28539830, 30099814, 30302807, 30387181, 30624782, 30774369		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	24282087, 26617733, 28539830, 35356854, 35799265	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Carcinoma	Ovarian Carcinoma	BEFREE	24604117, 26877780		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Diseases	Ovarian diseases	Pubtator	23029477	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	21858223, 22589409, 24604117, 25411964, 25426548, 27167337, 27593933, 30129654, 30236833		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	21720365, 21858223, 22589409, 24604117, 24885308, 25411964, 27167337, 28416635, 29545475, 31858531, 31987036, 33235818, 33721456, 33890574, 35624501, 37445993 View all (1 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	24824601	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	15492844, 17804744, 20354770, 21503965, 22194465, 23598278, 24418574, 24479803, 24634381, 28258481, 30352219, 30367545, 30538111, 30628173, 30705403, 30782607, 31334335, 31598398 View all (3 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	24859161, 24993031, 26451068, 31485660		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	BEFREE	17804744, 23598278, 26876216		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	20354770, 21503965, 24418574, 32429421, 33867818, 34117362, 35614040, 36622275	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	30367545	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	22049175, 22919068		★★★★★ ★☆☆☆☆ Found in Text Mining only
Patent ductus arteriosus	Patent ductus arteriosus	BEFREE	24993031, 26451068, 26876216		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pheochromocytoma	Pheochromocytoma	BEFREE	11152283		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pituitary Neoplasms	Pituitary neoplasm	Pubtator	26264222	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	37473924	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor B-cell lymphoblastic leukemia	Lymphoblastic Leukemia	BEFREE	25753524		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	25557384, 25760224, 30646895		★★★★★ ★☆☆☆☆ Found in Text Mining only
Progeria	Progeria	BEFREE	17014965, 30026603		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	15753356, 16452231, 21606178, 24583551, 24676803, 24823640, 25254494, 27108958, 27213551, 27324222, 28199985, 28677763, 29313393, 29554906, 30719174, 30996073, 31364741 View all (2 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	16452231, 25254494		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	17430594, 23775078, 28199985, 28677763, 29462661, 29554906, 31225930, 31364741, 34654353, 34864822, 35392496, 36891298	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pseudohyperkalemia Cardiff	Pseudohyperkalemia Cardiff	BEFREE	21836471		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Arterial Hypertension	Pulmonary arterial hypertension	Pubtator	22033266, 31437238	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	29290032, 30092353, 31190319, 31437238		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	23288041, 29733296		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary fibrosis	Pubtator	33601175	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal carcinoma	Renal Carcinoma	BEFREE	30066895		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	28902136, 29792186, 30609136		★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Adult	Respiratory Distress Syndrome	BEFREE	27090785		★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiratory Failure	Respiratory Failure	BEFREE	20816795		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	19749794, 28387346, 29312532, 30060118, 30374061, 30463534, 30795624		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	Pubtator	30060118, 32152631	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	BEFREE	23002205, 26553361		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	Pubtator	26553361	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma Alveolar	Rhabdomyosarcoma	Pubtator	26553361	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma Embryonal	Rhabdomyosarcoma	Pubtator	26553361	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Right Ventricular Hypertrophy	Ventricular hypertrophy	BEFREE	30092353		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	19956606, 27439614		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	Pubtator	26080399, 33564073	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma Synovial	Synovial sarcoma	Pubtator	27439614	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Secondary malignant neoplasm of colon and/or rectum	Colorectal Neoplasms	BEFREE	30744076		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sepsis	Sepsis	Pubtator	27090785	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	27090785, 29540208, 31121134		★★★★★ ★☆☆☆☆ Found in Text Mining only
Severe Combined Immunodeficiency	Severe combined immunodeficiency disease	BEFREE	21154750		★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin neoplasm	Pubtator	20187950	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	29228593		★★★★★ ★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	26871945	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	12183437, 19287496, 22126565, 23034676, 24114764, 26563366, 27409343, 29443638, 30452757, 30655797, 30942437, 31465124		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	29552222, 29596365, 29682174, 29877046, 30485581, 30655820		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	19287496, 22461910, 24114764, 25229973, 26084130, 27409343, 28848994, 29360662, 30942437, 30978209, 33093209, 33255409, 33420101, 33892811, 36801643	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of lung	Lung carcinoma	BEFREE	31324812		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of mouth	Oral cavity carcinoma	BEFREE	19525975		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of oropharynx	Oropharyngeal carcinoma	BEFREE	22109759		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	19287496, 20400365, 22461910, 25229973, 31465124		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the hypopharynx	Hypopharyngeal Carcinoma	BEFREE	28848994		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of tongue	Tongue carcinoma	BEFREE	29360662		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	19235838, 19351851, 24004449, 24628949, 24715000, 24726291, 25633416, 26164001, 26261559, 26451068, 27086911, 27185371, 27455555, 28078605, 28276310 View all (11 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Diseases	Stomach disease	Pubtator	36401232	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	22969238, 24004449, 24204899, 24628949, 26164001, 26261559, 26576650, 26790640, 26831669, 28078605, 28184921, 29424899, 30250169, 30569124, 33451982 View all (4 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
synovial sarcoma	Synovial sarcoma	BEFREE	27439614, 28759137, 30814111		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	28187428, 39376176	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	22919068		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Carcinoma Anaplastic	Thyroid cancer	Pubtator	31183379	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Carcinoma Anaplastic	Thyroid cancer	Pubtator	32887540, 39376176	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	22919068		★★★★★ ★☆☆☆☆ Found in Text Mining only
Tongue Neoplasms	Tongue Neoplasms	BEFREE	29443638		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	22581827, 26918606, 27303043, 28361350, 29301506, 29748184, 30206781, 30365046, 30419349, 30572639, 30729279, 30883132, 31359594, 31554904		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	27277416	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	27303043, 29301506, 30305342, 31359594, 33835503, 34206484, 34880209, 35524313, 36424525, 39428479	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	23325617, 24999187, 28498805, 29303511, 29397866, 29959570, 34650035, 35685866, 38070277, 39456780	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urothelial Carcinoma	Urothelial Carcinoma	BEFREE	28498805		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Dysplasia	Uterine disease	Pubtator	35008799	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	23819460, 24166507, 25066298, 28978307, 29343703, 30720158, 30856345, 31831728, 33235818, 33829064, 35141332, 37272088, 38537385	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	26839042		★★★★★ ★☆☆☆☆ Found in Text Mining only
X-linked agammaglobulinemia	Agammaglobulinemia, X-Linked	BEFREE	10196129		★★★★★ ★☆☆☆☆ Found in Text Mining only

FOXM1 (forkhead box M1)