KIF21B (kinesin family member 21B)

Gene

• Entrez ID: 23046
• Gene name: Kinesin family member 21B
• Gene symbol: KIF21B
• Synonyms (NCBI Gene): -
• Chromosome: 1
• Chromosome location: 1q32.1
• Summary: This gene encodes a member of the kinesin superfamily. Kinesins are ATP-dependent microtubule-based motor proteins that are involved in the intracellular transport of membranous organelles. Single nucleotide polymorphisms in this gene are associated with

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT029731	hsa-miR-26b-5p	Microarray	19088304
MIRT489195	hsa-miR-6854-5p	PAR-CLIP	23592263
MIRT489194	hsa-miR-3922-5p	PAR-CLIP	23592263
MIRT489193	hsa-miR-455-3p	PAR-CLIP	23592263
MIRT489192	hsa-miR-1910-5p	PAR-CLIP	23592263
MIRT489191	hsa-miR-6814-5p	PAR-CLIP	23592263
MIRT489190	hsa-miR-4264	PAR-CLIP	23592263
MIRT489189	hsa-miR-3670	PAR-CLIP	23592263
MIRT489187	hsa-miR-4633-3p	PAR-CLIP	23592263
MIRT489188	hsa-miR-6500-5p	PAR-CLIP	23592263
MIRT489186	hsa-miR-6874-5p	PAR-CLIP	23592263
MIRT489185	hsa-miR-484	PAR-CLIP	23592263
MIRT440370	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT440370	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT489195	hsa-miR-6854-5p	PAR-CLIP	23592263
MIRT489194	hsa-miR-3922-5p	PAR-CLIP	23592263
MIRT489193	hsa-miR-455-3p	PAR-CLIP	23592263
MIRT489192	hsa-miR-1910-5p	PAR-CLIP	23592263
MIRT489191	hsa-miR-6814-5p	PAR-CLIP	23592263
MIRT489190	hsa-miR-4264	PAR-CLIP	23592263
MIRT489189	hsa-miR-3670	PAR-CLIP	23592263
MIRT489187	hsa-miR-4633-3p	PAR-CLIP	23592263
MIRT489188	hsa-miR-6500-5p	PAR-CLIP	23592263
MIRT489186	hsa-miR-6874-5p	PAR-CLIP	23592263
MIRT489185	hsa-miR-484	PAR-CLIP	23592263
MIRT1094119	hsa-miR-1205	CLIP-seq
MIRT1094120	hsa-miR-1224-5p	CLIP-seq
MIRT1094121	hsa-miR-1251	CLIP-seq
MIRT1094122	hsa-miR-1272	CLIP-seq
MIRT1094123	hsa-miR-1275	CLIP-seq
MIRT1094124	hsa-miR-1285	CLIP-seq
MIRT1094125	hsa-miR-1286	CLIP-seq
MIRT1094126	hsa-miR-1291	CLIP-seq
MIRT1094127	hsa-miR-129-5p	CLIP-seq
MIRT1094128	hsa-miR-1470	CLIP-seq
MIRT1094129	hsa-miR-15a	CLIP-seq
MIRT1094130	hsa-miR-15b	CLIP-seq
MIRT1094131	hsa-miR-16	CLIP-seq
MIRT1094132	hsa-miR-185	CLIP-seq
MIRT1094133	hsa-miR-186	CLIP-seq
MIRT1094134	hsa-miR-1908	CLIP-seq
MIRT1094135	hsa-miR-1909	CLIP-seq
MIRT1094136	hsa-miR-1913	CLIP-seq
MIRT1094137	hsa-miR-1914	CLIP-seq
MIRT1094138	hsa-miR-195	CLIP-seq
MIRT1094139	hsa-miR-1976	CLIP-seq
MIRT1094140	hsa-miR-214	CLIP-seq
MIRT1094141	hsa-miR-2278	CLIP-seq
MIRT1094142	hsa-miR-24	CLIP-seq
MIRT1094143	hsa-miR-2861	CLIP-seq
MIRT1094144	hsa-miR-3147	CLIP-seq
MIRT1094145	hsa-miR-3151	CLIP-seq
MIRT1094146	hsa-miR-3155	CLIP-seq
MIRT1094147	hsa-miR-3155b	CLIP-seq
MIRT1094148	hsa-miR-3174	CLIP-seq
MIRT1094149	hsa-miR-3175	CLIP-seq
MIRT1094150	hsa-miR-3180	CLIP-seq
MIRT1094151	hsa-miR-3180-3p	CLIP-seq
MIRT1094152	hsa-miR-3187-5p	CLIP-seq
MIRT1094153	hsa-miR-3194-3p	CLIP-seq
MIRT1094154	hsa-miR-3196	CLIP-seq
MIRT1094155	hsa-miR-3202	CLIP-seq
MIRT1094156	hsa-miR-324-3p	CLIP-seq
MIRT1094157	hsa-miR-3619-5p	CLIP-seq
MIRT1094158	hsa-miR-365	CLIP-seq
MIRT1094159	hsa-miR-3663-3p	CLIP-seq
MIRT1094160	hsa-miR-3682-3p	CLIP-seq
MIRT1094161	hsa-miR-3689a-5p	CLIP-seq
MIRT1094162	hsa-miR-3689b	CLIP-seq
MIRT1094163	hsa-miR-3689e	CLIP-seq
MIRT1094164	hsa-miR-3689f	CLIP-seq
MIRT1094165	hsa-miR-3918	CLIP-seq
MIRT1094166	hsa-miR-3925-3p	CLIP-seq
MIRT1094167	hsa-miR-3945	CLIP-seq
MIRT1094168	hsa-miR-424	CLIP-seq
MIRT1094169	hsa-miR-4253	CLIP-seq
MIRT1094170	hsa-miR-4256	CLIP-seq
MIRT1094171	hsa-miR-4259	CLIP-seq
MIRT1094172	hsa-miR-4260	CLIP-seq
MIRT1094173	hsa-miR-4268	CLIP-seq
MIRT1094174	hsa-miR-4269	CLIP-seq
MIRT1094175	hsa-miR-4271	CLIP-seq
MIRT1094176	hsa-miR-4283	CLIP-seq
MIRT1094177	hsa-miR-4287	CLIP-seq
MIRT1094178	hsa-miR-4291	CLIP-seq
MIRT1094179	hsa-miR-4306	CLIP-seq
MIRT1094180	hsa-miR-4313	CLIP-seq
MIRT1094181	hsa-miR-4425	CLIP-seq
MIRT1094182	hsa-miR-4428	CLIP-seq
MIRT1094183	hsa-miR-4436a	CLIP-seq
MIRT1094184	hsa-miR-4436b-3p	CLIP-seq
MIRT1094185	hsa-miR-4448	CLIP-seq
MIRT1094186	hsa-miR-4469	CLIP-seq
MIRT1094187	hsa-miR-4471	CLIP-seq
MIRT1094188	hsa-miR-4474-3p	CLIP-seq
MIRT1094189	hsa-miR-4476	CLIP-seq
MIRT1094190	hsa-miR-4481	CLIP-seq
MIRT1094191	hsa-miR-4487	CLIP-seq
MIRT1094192	hsa-miR-4488	CLIP-seq
MIRT1094193	hsa-miR-4489	CLIP-seq
MIRT1094194	hsa-miR-4514	CLIP-seq
MIRT1094195	hsa-miR-4532	CLIP-seq
MIRT1094196	hsa-miR-4534	CLIP-seq
MIRT1094197	hsa-miR-4640-5p	CLIP-seq
MIRT1094198	hsa-miR-4644	CLIP-seq
MIRT1094199	hsa-miR-4645-5p	CLIP-seq
MIRT1094200	hsa-miR-4651	CLIP-seq
MIRT1094201	hsa-miR-4665-5p	CLIP-seq
MIRT1094202	hsa-miR-4667-3p	CLIP-seq
MIRT1094203	hsa-miR-4673	CLIP-seq
MIRT1094204	hsa-miR-4685-3p	CLIP-seq
MIRT1094205	hsa-miR-4688	CLIP-seq
MIRT1094206	hsa-miR-4692	CLIP-seq
MIRT1094207	hsa-miR-4697-5p	CLIP-seq
MIRT1094208	hsa-miR-4700-3p	CLIP-seq
MIRT1094209	hsa-miR-4706	CLIP-seq
MIRT1094210	hsa-miR-4714-5p	CLIP-seq
MIRT1094211	hsa-miR-4717-5p	CLIP-seq
MIRT1094212	hsa-miR-4722-5p	CLIP-seq
MIRT1094213	hsa-miR-4723-5p	CLIP-seq
MIRT1094214	hsa-miR-4725-3p	CLIP-seq
MIRT1094215	hsa-miR-4726-5p	CLIP-seq
MIRT1094216	hsa-miR-4728-3p	CLIP-seq
MIRT1094217	hsa-miR-4730	CLIP-seq
MIRT1094218	hsa-miR-4731-5p	CLIP-seq
MIRT1094219	hsa-miR-4742-5p	CLIP-seq
MIRT1094220	hsa-miR-4745-5p	CLIP-seq
MIRT1094221	hsa-miR-4747-5p	CLIP-seq
MIRT1094222	hsa-miR-4749-5p	CLIP-seq
MIRT1094223	hsa-miR-4751	CLIP-seq
MIRT1094224	hsa-miR-4759	CLIP-seq
MIRT1094225	hsa-miR-4763-5p	CLIP-seq
MIRT1094226	hsa-miR-4768-3p	CLIP-seq
MIRT1094227	hsa-miR-497	CLIP-seq
MIRT1094228	hsa-miR-574-5p	CLIP-seq
MIRT1094229	hsa-miR-608	CLIP-seq
MIRT1094230	hsa-miR-609	CLIP-seq
MIRT1094231	hsa-miR-612	CLIP-seq
MIRT1094232	hsa-miR-637	CLIP-seq
MIRT1094233	hsa-miR-645	CLIP-seq
MIRT1094234	hsa-miR-663	CLIP-seq
MIRT1094235	hsa-miR-671-3p	CLIP-seq
MIRT1094236	hsa-miR-760	CLIP-seq
MIRT1094237	hsa-miR-761	CLIP-seq
MIRT1094238	hsa-miR-765	CLIP-seq
MIRT1094239	hsa-miR-921	CLIP-seq
MIRT1094240	hsa-miR-922	CLIP-seq
MIRT1094241	hsa-miR-938	CLIP-seq
MIRT1094242	hsa-miR-940	CLIP-seq
MIRT1550576	hsa-miR-342-5p	CLIP-seq
MIRT1094200	hsa-miR-4651	CLIP-seq
MIRT1550577	hsa-miR-4664-5p	CLIP-seq
MIRT1094229	hsa-miR-608	CLIP-seq
MIRT1094238	hsa-miR-765	CLIP-seq
MIRT2025227	hsa-miR-1202	CLIP-seq
MIRT1094119	hsa-miR-1205	CLIP-seq
MIRT2025228	hsa-miR-1321	CLIP-seq
MIRT2025229	hsa-miR-151-5p	CLIP-seq
MIRT2025230	hsa-miR-151b	CLIP-seq
MIRT1094135	hsa-miR-1909	CLIP-seq
MIRT1094136	hsa-miR-1913	CLIP-seq
MIRT1094139	hsa-miR-1976	CLIP-seq
MIRT2025231	hsa-miR-2355-5p	CLIP-seq
MIRT1094142	hsa-miR-24	CLIP-seq
MIRT2025232	hsa-miR-3117-5p	CLIP-seq
MIRT1094146	hsa-miR-3155	CLIP-seq
MIRT1094147	hsa-miR-3155b	CLIP-seq
MIRT1094148	hsa-miR-3174	CLIP-seq
MIRT2025233	hsa-miR-3189-5p	CLIP-seq
MIRT1094153	hsa-miR-3194-3p	CLIP-seq
MIRT1094156	hsa-miR-324-3p	CLIP-seq
MIRT2025234	hsa-miR-3616-3p	CLIP-seq
MIRT2025235	hsa-miR-3660	CLIP-seq
MIRT2025236	hsa-miR-370	CLIP-seq
MIRT2025237	hsa-miR-384	CLIP-seq
MIRT2025238	hsa-miR-3944-5p	CLIP-seq
MIRT2025239	hsa-miR-3972	CLIP-seq
MIRT1094173	hsa-miR-4268	CLIP-seq
MIRT1094184	hsa-miR-4436b-3p	CLIP-seq
MIRT2025240	hsa-miR-4447	CLIP-seq
MIRT1094185	hsa-miR-4448	CLIP-seq
MIRT2025241	hsa-miR-4472	CLIP-seq
MIRT1094190	hsa-miR-4481	CLIP-seq
MIRT2025242	hsa-miR-4492	CLIP-seq
MIRT2025243	hsa-miR-4494	CLIP-seq
MIRT2025244	hsa-miR-4498	CLIP-seq
MIRT2025245	hsa-miR-4526	CLIP-seq
MIRT1094195	hsa-miR-4532	CLIP-seq
MIRT1094197	hsa-miR-4640-5p	CLIP-seq
MIRT1094199	hsa-miR-4645-5p	CLIP-seq
MIRT1094200	hsa-miR-4651	CLIP-seq
MIRT2025246	hsa-miR-4660	CLIP-seq
MIRT1094203	hsa-miR-4673	CLIP-seq
MIRT2025247	hsa-miR-4709-3p	CLIP-seq
MIRT1094215	hsa-miR-4726-5p	CLIP-seq
MIRT1094218	hsa-miR-4731-5p	CLIP-seq
MIRT2025248	hsa-miR-4739	CLIP-seq
MIRT1094220	hsa-miR-4745-5p	CLIP-seq
MIRT1094221	hsa-miR-4747-5p	CLIP-seq
MIRT2025249	hsa-miR-4756-5p	CLIP-seq
MIRT2025250	hsa-miR-4758-5p	CLIP-seq
MIRT1094225	hsa-miR-4763-5p	CLIP-seq
MIRT2025251	hsa-miR-564	CLIP-seq
MIRT1094229	hsa-miR-608	CLIP-seq
MIRT2025252	hsa-miR-628-5p	CLIP-seq
MIRT2025253	hsa-miR-636	CLIP-seq
MIRT1094236	hsa-miR-760	CLIP-seq
MIRT2025254	hsa-miR-762	CLIP-seq
MIRT1094240	hsa-miR-922	CLIP-seq
MIRT2256499	hsa-miR-1207-3p	CLIP-seq
MIRT2256500	hsa-miR-1207-5p	CLIP-seq
MIRT2256501	hsa-miR-1252	CLIP-seq
MIRT2256502	hsa-miR-1262	CLIP-seq
MIRT2256503	hsa-miR-1266	CLIP-seq
MIRT2256504	hsa-miR-1297	CLIP-seq
MIRT2256505	hsa-miR-140-3p	CLIP-seq
MIRT1094134	hsa-miR-1908	CLIP-seq
MIRT1094136	hsa-miR-1913	CLIP-seq
MIRT2256506	hsa-miR-193a-5p	CLIP-seq
MIRT1094140	hsa-miR-214	CLIP-seq
MIRT2256507	hsa-miR-218	CLIP-seq
MIRT1094141	hsa-miR-2278	CLIP-seq
MIRT2025231	hsa-miR-2355-5p	CLIP-seq
MIRT2256508	hsa-miR-26a	CLIP-seq
MIRT2256509	hsa-miR-26b	CLIP-seq
MIRT2256510	hsa-miR-27a	CLIP-seq
MIRT2256511	hsa-miR-27b	CLIP-seq
MIRT1094143	hsa-miR-2861	CLIP-seq
MIRT2256512	hsa-miR-3140-5p	CLIP-seq
MIRT1094145	hsa-miR-3151	CLIP-seq
MIRT1094146	hsa-miR-3155	CLIP-seq
MIRT1094147	hsa-miR-3155b	CLIP-seq
MIRT1094150	hsa-miR-3180	CLIP-seq
MIRT1094151	hsa-miR-3180-3p	CLIP-seq
MIRT2025233	hsa-miR-3189-5p	CLIP-seq
MIRT1094154	hsa-miR-3196	CLIP-seq
MIRT1094155	hsa-miR-3202	CLIP-seq
MIRT1094156	hsa-miR-324-3p	CLIP-seq
MIRT2025234	hsa-miR-3616-3p	CLIP-seq
MIRT1094157	hsa-miR-3619-5p	CLIP-seq
MIRT1094158	hsa-miR-365	CLIP-seq
MIRT2256513	hsa-miR-3652	CLIP-seq
MIRT2256514	hsa-miR-3664-3p	CLIP-seq
MIRT2256515	hsa-miR-3921	CLIP-seq
MIRT2256516	hsa-miR-425	CLIP-seq
MIRT1094174	hsa-miR-4269	CLIP-seq
MIRT1094175	hsa-miR-4271	CLIP-seq
MIRT2256517	hsa-miR-4430	CLIP-seq
MIRT1094184	hsa-miR-4436b-3p	CLIP-seq
MIRT2256518	hsa-miR-4446-3p	CLIP-seq
MIRT2025240	hsa-miR-4447	CLIP-seq
MIRT2256519	hsa-miR-4465	CLIP-seq
MIRT2025241	hsa-miR-4472	CLIP-seq
MIRT2256520	hsa-miR-4475	CLIP-seq
MIRT2025242	hsa-miR-4492	CLIP-seq
MIRT2025243	hsa-miR-4494	CLIP-seq
MIRT2025244	hsa-miR-4498	CLIP-seq
MIRT2256521	hsa-miR-4505	CLIP-seq
MIRT2256522	hsa-miR-4518	CLIP-seq
MIRT2256523	hsa-miR-4530	CLIP-seq
MIRT1094195	hsa-miR-4532	CLIP-seq
MIRT1094200	hsa-miR-4651	CLIP-seq
MIRT2256524	hsa-miR-4653-5p	CLIP-seq
MIRT2256525	hsa-miR-4701-3p	CLIP-seq
MIRT2256526	hsa-miR-4707-5p	CLIP-seq
MIRT1094214	hsa-miR-4725-3p	CLIP-seq
MIRT1094218	hsa-miR-4731-5p	CLIP-seq
MIRT1094221	hsa-miR-4747-5p	CLIP-seq
MIRT2256527	hsa-miR-4763-3p	CLIP-seq
MIRT2256528	hsa-miR-4773	CLIP-seq
MIRT2256529	hsa-miR-486-3p	CLIP-seq
MIRT2256530	hsa-miR-491-5p	CLIP-seq
MIRT2256531	hsa-miR-502-5p	CLIP-seq
MIRT2256532	hsa-miR-513a-5p	CLIP-seq
MIRT2256533	hsa-miR-541	CLIP-seq
MIRT2256534	hsa-miR-549	CLIP-seq
MIRT2025251	hsa-miR-564	CLIP-seq
MIRT1094229	hsa-miR-608	CLIP-seq
MIRT2256535	hsa-miR-654-5p	CLIP-seq
MIRT1094234	hsa-miR-663	CLIP-seq
MIRT1094236	hsa-miR-760	CLIP-seq
MIRT1094237	hsa-miR-761	CLIP-seq
MIRT2025254	hsa-miR-762	CLIP-seq
MIRT2256536	hsa-miR-942	CLIP-seq
MIRT1094124	hsa-miR-1285	CLIP-seq
MIRT1094134	hsa-miR-1908	CLIP-seq
MIRT2389867	hsa-miR-198	CLIP-seq
MIRT1094150	hsa-miR-3180	CLIP-seq
MIRT1094151	hsa-miR-3180-3p	CLIP-seq
MIRT1094152	hsa-miR-3187-5p	CLIP-seq
MIRT1094154	hsa-miR-3196	CLIP-seq
MIRT1094199	hsa-miR-4645-5p	CLIP-seq
MIRT1094200	hsa-miR-4651	CLIP-seq
MIRT1094203	hsa-miR-4673	CLIP-seq
MIRT1094213	hsa-miR-4723-5p	CLIP-seq
MIRT1094218	hsa-miR-4731-5p	CLIP-seq
MIRT1094229	hsa-miR-608	CLIP-seq
MIRT1094231	hsa-miR-612	CLIP-seq
MIRT2389868	hsa-miR-615-5p	CLIP-seq
MIRT1094234	hsa-miR-663	CLIP-seq
MIRT2452593	hsa-miR-3136-3p	CLIP-seq
MIRT1094184	hsa-miR-4436b-3p	CLIP-seq
MIRT2025247	hsa-miR-4709-3p	CLIP-seq
MIRT1094216	hsa-miR-4728-3p	CLIP-seq
MIRT2557972	hsa-miR-1273g	CLIP-seq
MIRT2025231	hsa-miR-2355-5p	CLIP-seq
MIRT2557972	hsa-miR-1273g	CLIP-seq
MIRT1094123	hsa-miR-1275	CLIP-seq
MIRT2683444	hsa-miR-2355-3p	CLIP-seq
MIRT2025231	hsa-miR-2355-5p	CLIP-seq
MIRT1094172	hsa-miR-4260	CLIP-seq
MIRT2683445	hsa-miR-4646-3p	CLIP-seq
MIRT1094201	hsa-miR-4665-5p	CLIP-seq
MIRT1094230	hsa-miR-609	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0003777	Function	Microtubule motor activity	IBA
GO:0003777	Function	Microtubule motor activity	IEA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005524	Function	ATP binding	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005856	Component	Cytoskeleton	IEA
GO:0005871	Component	Kinesin complex	IBA
GO:0005874	Component	Microtubule	IBA
GO:0005874	Component	Microtubule	IEA
GO:0007018	Process	Microtubule-based movement	IBA
GO:0007018	Process	Microtubule-based movement	IEA
GO:0008017	Function	Microtubule binding	IBA
GO:0008017	Function	Microtubule binding	IEA
GO:0016887	Function	ATP hydrolysis activity	IBA
GO:0030424	Component	Axon	IEA
GO:0030425	Component	Dendrite	IEA
GO:0030426	Component	Growth cone	IEA
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0042995	Component	Cell projection	IEA

Other IDs

• MIM: 608322
• HGNC: 29442
• e!Ensembl: ENSG00000116852

Protein

• UniProt ID: O75037
• Protein name: Kinesin-like protein KIF21B
• Protein function: Plus-end directed microtubule-dependent motor protein which displays processive activity. Is involved in regulation of microtubule dynamics, synapse function and neuronal morphology, including dendritic tree branching and spine formation. Plays
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00225	Kinesin	14 → 370	Kinesin motor domain	Domain
  PF00400	WD40	1298 → 1334	WD domain, G-beta repeat	Repeat
  PF00400	WD40	1443 → 1484	WD domain, G-beta repeat	Repeat
  PF00400	WD40	1535 → 1573	WD domain, G-beta repeat	Repeat
  PF00400	WD40	1577 → 1613	WD domain, G-beta repeat	Repeat

• Sequence:

  MAGQGDCCVKVAVRIRPQLSKEKIEGCHICTSVTPGEPQVLLGKDKAFTYDFVFDLDTWQ
  EQIYSTCVSKLIEGCFEGYNATVLAYGQTGAGKTYTMGTGFDMATSEEEQGIIPRAIAHL
  FGGIAERKRRAQEQGVAGPEFKVSAQFLELYNEEILDLFDSTRDPDTRHRRSNIKIHEDA
  NGGIYTTGVTSRLIHSQEELIQCLKQGALSRTTASTQMNVQSSRSHAIFTIHLCQMRMCT
  QPDLVNEAVTGLPDGTPPSSEYETLTAKFHFVDLAGSERLKRTGATGERAKEGISINCGL
  LALGNVISALGDQSKKVVHVPYRDSKLTRLLQDSLGGNSQTIMIACVSPSDRDFMETLNT
  LKYANRARNIKNKVVVNQDKTSQQISALRAEIARLQMELMEYKAGKRVIGEDGAEGYSDL
  FRENAMLQKENGALRLRVKAMQEAIDAINNRVTQLMSQEANLLLAKAGDGNEAIGALIQN
  YIREIEELRTKLLESEAMNESLRRSLSRASARSPYSLGASPAAPAFGGSPASSMEDASEV
  IRRAKQDLERLKKKEVRQRRKSPEKEAFKKRAKLQQENSEETDENEAEEEEEERDESGCE
  EEEGREDEDEDSGSEESLVDSDSDPEEKEVNFQADLADLTCEIEIKQKLIDELENSQRRL
  QTLKHQYEEKLILLQNKIRDTQLERDRVLQNLSTMECYTEEKANKIKADYEKRLREMNRD
  LQKLQAAQKEHARLLKNQSRYERELKKLQAEVAEMKKAKVALMKQMREEQQRRRLVETKR
  NREIAQLKKEQRRQEFQIRALESQKRQQEMVLRRKTQEVSALRRLAKPMSERVAGRAGLK
  PPMLDSGAEVSASTTSSEAESGARSVSSIVRQWNRKINHFLGDHPAPTVNGTRPARKKFQ
  KKGASQSFSKAARLKWQSLERRIIDIVMQRMTIVNLEADMERLIKKREELFLLQEALRRK
  RERLQAESPEEEKGLQELAEEIEVLAANIDYINDGITDCQATIVQLEETKEELDSTDTSV
  VISSCSLAEARLLLDNFLKASIDKGLQVAQKEAQIRLLEGRLRQTDMAGSSQNHLLLDAL
  REKAEAHPELQALIYNVQQENGYASTDEEISEFSEGSFSQSFTMKGSTSHDDFKFKSEPK
  LSAQMKAVSAECLGPPLDISTKNITKSLASLVEIKEDGVGFSVRDPYYRDRVSRTVSLPT
  RGSTFPRQSRATETSPLTRRKSYDRGQPIRSTDVGFTPPSSPPTRPRNDRNVFSRLTSNQ
  SQGSALDKSDDSDSSLSEVLRGIISPVGGAKGARTAPLQCVSMAEGHTKPILCLDATDEL
  LFTGSKDRSCKMWNLVTGQEIAALKGHPNNVVSIKYCSHSGLVFSVSTSYIKVWDIRDSA
  KCIRTLTSSGQVISGDACAATSTRAITSAQGEHQINQIALSPSGTMLYAASGNAVRIWEL
  SRFQPVGKLTGHIGPVMCLTVTQTASQHDLVVTGSKDHYVKMFELGECVTGTIGPTHNFE
  PPHYDGIECLAIQGDILFSGSRDNGIKKWDLDQQELIQQIPNAHKDWVCALAFIPGRPML
  LSACRAGVIKVWNVDNFTPIGEIKGHDSPINAICTNAKHIFTASSDCRVKLWNYVPGLTP
  CLPRRVLAIKGRATTLP

• Sequence length: 1637

Pathways

KEGG:

Motor proteins

Reactome:

COPI-dependent Golgi-to-ER retrograde traffic
Kinesins

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
Acute myeloid leukemia	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANKYLOSING SPONDYLITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BILIARY LIVER CIRRHOSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cerebral ischemia	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC LEFT-SIDED ULCERATIVE COLITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLITIS, ULCERATIVE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHN'S DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypotonia	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIF21B-related disorder	Uncertain significance; Likely benign; Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIF21B-related Neurodevelopmental disorder	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Long QT syndrome	Uncertain significance	ClinVar Disgenet	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Lung cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Macrogyria	Uncertain significance	ClinVar Disgenet	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Moderate global developmental delay	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neurodevelopmental disorder	Uncertain significance; Conflicting classifications of pathogenicity	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEURODEVELOPMENTAL DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PRIMARY BILIARY CIRRHOSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ULCERATIVE COLITIS	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Alzheimer Disease	Alzheimer disease	Pubtator	25274010	Stimulate	★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	33794991	Associate	★☆☆☆☆ Found in Text Mining only
Alzheimer disease, familial, type 3	Alzheimer disease	BEFREE	25274010		★☆☆☆☆ Found in Text Mining only
Ankylosing spondylitis	Ankylosing Spondylitis	GWASDB_DG	21743469		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ankylosing spondylitis	Ankylosing Spondylitis	GWASCAT_DG	21743469		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ankylosing spondylitis	Ankylosing Spondylitis	BEFREE	24065353, 25149646		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	29847800		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	23300462		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	33346730	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	35341446	Associate	★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	Pubtator	27650971	Associate	★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	GWASDB_DG	18587394		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	25149646		★☆☆☆☆ Found in Text Mining only
Demyelinating Diseases	Demyelinating diseases	Pubtator	25274010	Associate	★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	20587413		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	Pubtator	36273157	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	20007504, 20587413, 24065353, 24144874, 25274010		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	20007504, 25274010	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	GWASDB_DG	21833088		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	25274010	Associate	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	25274010		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	34148545	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	30444038	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	35341446	Associate	★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	CTD_human_DG	20228799		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ulcerative Colitis	Ulcerative colitis	BEFREE	25149646		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uveitis Anterior	Anterior uveitis	Pubtator	25200001	Associate	★☆☆☆☆ Found in Text Mining only