Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	23040
Gene name	Myelin transcription factor 1 like
Gene symbol	MYT1L
Synonyms (NCBI Gene)	MRD39NZF1ZC2H2C2ZC2HC4BmyT1-L
Chromosome	2
Chromosome location	2p25.3
Summary	This gene encodes a member of the zinc finger superfamily of transcription factors whose expression, thus far, has been found only in neuronal tissues. The encoded protein belongs to a novel class of cystein-cystein-histidine-cystein zinc finger proteins

Show/Hide all (23)

SNP ID	Visualize variation	Clinical significance	Consequence
rs869320675	C>T	Pathogenic	Splice donor variant
rs869320676	A>C	Pathogenic	Coding sequence variant, stop gained
rs878853045	C>T	Likely-pathogenic, pathogenic	Coding sequence variant, missense variant
rs886041655	C>A	Pathogenic	Stop gained, coding sequence variant
rs886041858	G>A	Pathogenic	Stop gained, coding sequence variant
rs886041944	->C	Pathogenic	Coding sequence variant, frameshift variant
rs1057519560	A>G	Likely-pathogenic	Missense variant, coding sequence variant
rs1064793449	GC>A	Pathogenic	Coding sequence variant, frameshift variant
rs1064793635	G>-	Pathogenic	Coding sequence variant, frameshift variant
rs1064794713	G>A	Likely-pathogenic	Missense variant, coding sequence variant
rs1253072668	CAGCGCGTGG>-	Pathogenic	Coding sequence variant, frameshift variant
rs1275489527	C>T	Pathogenic	Coding sequence variant, missense variant
rs1553295440	C>A	Pathogenic	Stop gained, coding sequence variant
rs1553297209	C>-	Pathogenic	Frameshift variant, coding sequence variant
rs1553308328	C>T	Likely-pathogenic	Intron variant
rs1553324416	->C	Pathogenic	Frameshift variant, coding sequence variant
rs1553324762	G>-	Pathogenic	Frameshift variant, coding sequence variant
rs1553395132	T>C	Likely-pathogenic	Genic downstream transcript variant, splice acceptor variant
rs1558371790	G>A	Pathogenic	Coding sequence variant, missense variant
rs1558414255	G>A	Likely-pathogenic	Stop gained, coding sequence variant
rs1558710588	G>T	Likely-pathogenic	Missense variant, coding sequence variant, genic downstream transcript variant
rs1573483715	G>A	Likely-pathogenic	Coding sequence variant, missense variant
rs1573501865	C>A	Likely-pathogenic	Coding sequence variant, missense variant

Show/Hide all (79)

miRTarBase ID	miRNA	Experiments	Reference
MIRT017380	hsa-miR-335-5p	Microarray	18185580
MIRT029154	hsa-miR-26b-5p	Microarray	19088304
MIRT721408	hsa-miR-501-5p	HITS-CLIP	19536157
MIRT721407	hsa-miR-6792-5p	HITS-CLIP	19536157
MIRT721406	hsa-miR-4503	HITS-CLIP	19536157
MIRT721405	hsa-miR-7856-5p	HITS-CLIP	19536157
MIRT721408	hsa-miR-501-5p	HITS-CLIP	19536157
MIRT721407	hsa-miR-6792-5p	HITS-CLIP	19536157
MIRT721406	hsa-miR-4503	HITS-CLIP	19536157
MIRT721405	hsa-miR-7856-5p	HITS-CLIP	19536157
MIRT1170694	hsa-miR-106a	CLIP-seq
MIRT1170695	hsa-miR-106b	CLIP-seq
MIRT1170696	hsa-miR-1299	CLIP-seq
MIRT1170697	hsa-miR-17	CLIP-seq
MIRT1170698	hsa-miR-204	CLIP-seq
MIRT1170699	hsa-miR-20a	CLIP-seq
MIRT1170700	hsa-miR-20b	CLIP-seq
MIRT1170701	hsa-miR-211	CLIP-seq
MIRT1170702	hsa-miR-302a	CLIP-seq
MIRT1170703	hsa-miR-302b	CLIP-seq
MIRT1170704	hsa-miR-302c	CLIP-seq
MIRT1170705	hsa-miR-302d	CLIP-seq
MIRT1170706	hsa-miR-302e	CLIP-seq
MIRT1170707	hsa-miR-3120-3p	CLIP-seq
MIRT1170708	hsa-miR-3121-5p	CLIP-seq
MIRT1170709	hsa-miR-3143	CLIP-seq
MIRT1170710	hsa-miR-3151	CLIP-seq
MIRT1170711	hsa-miR-3202	CLIP-seq
MIRT1170712	hsa-miR-338-3p	CLIP-seq
MIRT1170713	hsa-miR-3613-3p	CLIP-seq
MIRT1170714	hsa-miR-3646	CLIP-seq
MIRT1170715	hsa-miR-372	CLIP-seq
MIRT1170716	hsa-miR-373	CLIP-seq
MIRT1170717	hsa-miR-4265	CLIP-seq
MIRT1170718	hsa-miR-4282	CLIP-seq
MIRT1170719	hsa-miR-4287	CLIP-seq
MIRT1170720	hsa-miR-4289	CLIP-seq
MIRT1170721	hsa-miR-4296	CLIP-seq
MIRT1170722	hsa-miR-4322	CLIP-seq
MIRT1170723	hsa-miR-4447	CLIP-seq
MIRT1170724	hsa-miR-4469	CLIP-seq
MIRT1170725	hsa-miR-4472	CLIP-seq
MIRT1170726	hsa-miR-4474-5p	CLIP-seq
MIRT1170727	hsa-miR-450b-5p	CLIP-seq
MIRT1170728	hsa-miR-4517	CLIP-seq
MIRT1170729	hsa-miR-4530	CLIP-seq
MIRT1170730	hsa-miR-4533	CLIP-seq
MIRT1170731	hsa-miR-4685-3p	CLIP-seq
MIRT1170732	hsa-miR-4762-5p	CLIP-seq
MIRT1170733	hsa-miR-491-5p	CLIP-seq
MIRT1170734	hsa-miR-512-3p	CLIP-seq
MIRT1170735	hsa-miR-519d	CLIP-seq
MIRT1170736	hsa-miR-520a-3p	CLIP-seq
MIRT1170737	hsa-miR-520b	CLIP-seq
MIRT1170738	hsa-miR-520c-3p	CLIP-seq
MIRT1170739	hsa-miR-520d-3p	CLIP-seq
MIRT1170740	hsa-miR-520e	CLIP-seq
MIRT1170741	hsa-miR-548p	CLIP-seq
MIRT1170742	hsa-miR-548t	CLIP-seq
MIRT1170743	hsa-miR-875-3p	CLIP-seq
MIRT1170744	hsa-miR-891b	CLIP-seq
MIRT1170745	hsa-miR-93	CLIP-seq
MIRT2049193	hsa-miR-142-5p	CLIP-seq
MIRT2049194	hsa-miR-4694-3p	CLIP-seq
MIRT2049195	hsa-miR-4708-5p	CLIP-seq
MIRT2049196	hsa-miR-522	CLIP-seq
MIRT2278287	hsa-miR-1252	CLIP-seq
MIRT2278288	hsa-miR-3140-3p	CLIP-seq
MIRT1170711	hsa-miR-3202	CLIP-seq
MIRT2278289	hsa-miR-3617	CLIP-seq
MIRT2278290	hsa-miR-3924	CLIP-seq
MIRT1170730	hsa-miR-4533	CLIP-seq
MIRT2049194	hsa-miR-4694-3p	CLIP-seq
MIRT2049195	hsa-miR-4708-5p	CLIP-seq
MIRT2278291	hsa-miR-4802-3p	CLIP-seq
MIRT2049196	hsa-miR-522	CLIP-seq
MIRT2278292	hsa-miR-587	CLIP-seq
MIRT2278293	hsa-miR-641	CLIP-seq
MIRT2391302	hsa-miR-600	CLIP-seq

Show/Hide all (34)

GO ID	Ontology	Definition	Evidence
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	ISS
GO:0000785	Component	Chromatin	ISA
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	IEA
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	ISS
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IEA
GO:0003677	Function	DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0003713	Function	Transcription coactivator activity	IEA
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	ISS
GO:0005694	Component	Chromosome	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	ISS
GO:0007399	Process	Nervous system development	IEA
GO:0007399	Process	Nervous system development	ISS
GO:0008270	Function	Zinc ion binding	IEA
GO:0030154	Process	Cell differentiation	IEA
GO:0030182	Process	Neuron differentiation	IEA
GO:0030182	Process	Neuron differentiation	ISS
GO:0044323	Function	Retinoic acid-responsive element binding	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0048663	Process	Neuron fate commitment	IEA
GO:0048663	Process	Neuron fate commitment	ISS
GO:0048665	Process	Neuron fate specification	IEA
GO:0048665	Process	Neuron fate specification	ISS
GO:0048666	Process	Neuron development	IEA
GO:0048666	Process	Neuron development	ISS
GO:0050897	Function	Cobalt ion binding	IEA
GO:0140487	Function	Metal ion sequestering activity	IEA

MIM	HGNC	e!Ensembl
613084	7623	ENSG00000186487

Q9UL68

Protein name

Myelin transcription factor 1-like protein (MyT1-L) (MyT1L)

Protein function

Transcription factor that plays a key role in neuronal differentiation by specifically repressing expression of non-neuronal genes during neuron differentiation. In contrast to other transcription repressors that inhibit specific lineages, media

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01530	zf-C2HC	30 → 58	Zinc finger, C2HC type	Family
PF01530	zf-C2HC	505 → 532	Zinc finger, C2HC type	Family
PF01530	zf-C2HC	549 → 577	Zinc finger, C2HC type	Family
PF08474	MYT1	621 → 872	Myelin transcription factor 1	Family
PF01530	zf-C2HC	904 → 932	Zinc finger, C2HC type	Family
PF01530	zf-C2HC	953 → 981	Zinc finger, C2HC type	Family
PF01530	zf-C2HC	1006 → 1034	Zinc finger, C2HC type	Family

Sequence

MEVDTEEKRHRTRSKGVRVPVEPAIQELFSCPTPGCDGSGHVSGKYARHRSVYGCPLAKK
RKTQDKQPQEPAPKRKPFAVKADSSSVDECDDSDGTEDMDEKEEDEGEEYSEDNDEPGDE
DEEDEEGDREEEEEIEEEDEDDDEDGEDVEDEEEEEEEEEEEEEEEENEDHQMNCHNTRI
MQDTEKDDNNNDEYDNYDELVAKSLLNLGKIAEDAAYRARTESEMNSNTSNSLEDDSDKN
ENLGRKSELSLDLDSDVVRETVDSLKLLAQGHGVVLSENMNDRNYADSMSQQDSRNMNYV
MLGKPMNNGLMEKMVEESDEEVCLSSLECLRNQCFDLARKLSETNPQERNPQQNMNIRQH
VRPEEDFPGRTPDRNYSDMLNLMRLEEQLSPRSRVFASCAKEDGCHERDDDTTSVNSDRS
EEVFDMTKGNLTLLEKAIALETERAKAMREKMAMEAGRRDNMRSYEDQSPRQLPGEDRKP
KSSDSHVKKPYYGKDPSRTEKKESKCPTPGCDGTGHVTGLYPHHRSLSGCPHKDRVPPEI
LAMHESVLKCPTPGCTGRGHVNSNRNSHRSLSGCPIAAAEKLAKAQEKHQSCDVSKSSQA
SDRVLRPMCFVKQLEIPQYGYRNNVPTTTPRSNLAKELEKYSKTSFEYNSYDNHTYGKRA
IAPKVQTRDISPKGYDDAKRYCKDPSPSSSSTSSYAPSSSSNLSCGGGSSASSTCSKSSF
DYTHDMEAAHMAATAILNLSTRCREMPQNLSTKPQDLCATRNPDMEVDENGTLDLSMNKQ
RPRDSCCPILTPLEPMSPQQQAVMNNRCFQLGEGDCWDLPVDYTKMKPRRIDEDESKDIT
PEDLDPFQEALEERRYPGEVTIPSPKPKYPQCKESKKDLITLSGCPLADKSIRSMLATSS
QELKCPTPGCDGSGHITGNYASHRSLSGCPRAKKSGIRIAQSKEDKEDQEPIRCPVPGCD
GQGHITGKYASHRSASGCPLAAKRQKDGYLNGSQFSWKSVKTEGMSCPTPGCDGSGHVSG
SFLTHRSLSGCPRATSAMKKAKLSGEQMLTIKQRASNGIENDEEIKQLDEEIKELNESNS
QMEADMIKLRTQITTMESNLKTIEEENKVIEQQNESLLHELANLSQSLIHSLANIQLPHM
DPINEQNFDAYVTTLTEMYTNQDRYQSPENKALLENIKQAVRGIQV

Sequence length

1186

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (6)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Intellectual disability	Likely pathogenic; Pathogenic	rs878853045, rs1253072668, rs1558371790, rs2048197122, rs2048544264, rs2052975031, rs2052976421, rs2052981382	RCV001257695 RCV001257694 RCV001255346 RCV001257692 RCV001257696 RCV001257693 RCV001257763 RCV001257762 View all (3 more)	★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Intellectual disability, autosomal dominant 39	Pathogenic; Likely pathogenic	rs2149016192, rs2148852029, rs2149110899, rs753426087, rs2149071963, rs528530098, rs2550898220, rs2550897780, rs2550356884, rs2550870899, rs2550701604, rs869320675, rs869320676, rs878853045, rs2550684752 View all (27 more)	RCV002291300 RCV001809065 RCV002074462 RCV002249108 RCV002267689 View all (37 more)	★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
MYT1L-related disorder	Pathogenic	rs2551024138	RCV003976728	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Neurodevelopmental abnormality	Pathogenic	rs2048967703	RCV001264697	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Neurodevelopmental delay	Likely pathogenic	rs2148393387, rs2148530498	RCV002274396 RCV002274397	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Neurodevelopmental disorder	Pathogenic; Likely pathogenic	rs2149016192, rs745333246	RCV001374947 RCV001374922	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (28)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ATOPIC ECZEMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autism spectrum disorder	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISTIC DISORDER	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLOR VISION DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC RETINOPATHY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Early onset severe obesity	Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IGA GLOMERULONEPHRITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY SKIN DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INTELLECTUAL DEVELOPMENTAL DISORDER, AUTOSOMAL DOMINANT 39	—	CTD, Disgenet, HPO CTD, Disgenet, HPO CTD, Disgenet, HPO	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METASTATIC COLORECTAL CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOOD DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEURODEVELOPMENTAL DISORDERS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEUROTIC DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA, CHILDHOOD	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Syndromic intellectual disability	not provided	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC SCLERODERMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thymoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ULCERATIVE COLITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UNIPOLAR DEPRESSION	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
URINARY BLADDER CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine carcinosarcoma	Likely benign; Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uveal melanoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (70)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adult Oligodendroglioma	Oligodendroglioma	BEFREE	14997935		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	38554950	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Aphasia	Aphasia	Pubtator	24129437	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	35606283	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
ATRIAL SEPTAL DEFECT 1	Atrial Septal Defect	GENOMICS_ENGLAND_DG	25294932		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrial Septal Defects	Atrial Septal Defect	GENOMICS_ENGLAND_DG	25294932		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorder	Autism	Pubtator	27824329, 35741772, 38136944	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autism Spectrum Disorders	Autism Spectrum Disorder	GENOMICS_ENGLAND_DG	25294932		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	BEFREE	22157634		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autistic Disorder	Autism	Pubtator	22157634, 27824329, 34748075	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autosomal dominant non-syndromic intellectual disability	Non-Syndromic Intellectual Disability	Orphanet			★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	30312684		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Oligodendroglioma	Oligodendroglioma	BEFREE	14997935		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital Abnormalities	Congenital abnormalities	Pubtator	34748075	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystitis Interstitial	Interstitial cystitis	Pubtator	30973927	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Demyelinating Diseases	Demyelinating Diseases	BEFREE	29397565		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	22157634, 29397565		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive Disorder	Major depressive disorder	Pubtator	22157634	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive Disorder Major	Major depressive disorder	Pubtator	21048971, 35468096	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	GWASCAT_DG	25574825		★★★★★ ★☆☆☆☆ Found in Text Mining only
Developmental Disabilities	Developmental disability	Pubtator	28470180, 34748075	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	Pubtator	34748075	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	29291346, 30312684		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	31522595, 40362634	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	23918370, 29291346, 30312684		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	23918370		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	34848272	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Global developmental delay	Developmental Delay	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	GWASCAT_DG	26252872		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	BEFREE	21990140, 25232846, 28470180, 28859103, 29397565, 30055078, 30796847		★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Intellectual Disability	Mental retardation	GENOMICS_ENGLAND_DG	21990140, 26240977		★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Intellectual Disability	Intellectual developmental disorder	Pubtator	28470180, 34748075	Associate	★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Intellectual Disability	Mental retardation	HPO_DG			★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Language Development Disorders	Language development disorders	Pubtator	34748075	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Learning Disabilities	Learning disorders	Pubtator	34748075	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	21048971, 21923761		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Major Depressive Disorder	Mental Depression	PSYGENET_DG	21048971		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant neoplasm of breast	Breast Cancer	BEFREE	30312684		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	24015200		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	24252690, 28470180		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	22157634, 29397565		★★★★★ ★☆☆☆☆ Found in Text Mining only
MENTAL RETARDATION, AUTOSOMAL DOMINANT 39	Mental retardation	GENOMICS_ENGLAND_DG	21990140, 26240977		★★★★★ ★☆☆☆☆ Found in Text Mining only
MENTAL RETARDATION, AUTOSOMAL DOMINANT 39	Mental retardation	BEFREE	30796847		★★★★★ ★☆☆☆☆ Found in Text Mining only
MENTAL RETARDATION, AUTOSOMAL DOMINANT 39	Mental retardation	CLINVAR_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
MENTAL RETARDATION, AUTOSOMAL DOMINANT 39	Mental retardation	CTD_human_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	23412934	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	31522595		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	28470180	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodevelopmental Disorders	Neurodevelopmental Disorders	CTD_human_DG	28191889		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neurodevelopmental Disorders	Neurodevelopmental Disorders	BEFREE	28470180		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Non-specific syndromic intellectual disability	Syndromic Mental Retardation	Orphanet			★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	GENOMICS_ENGLAND_DG	21990140, 26240977		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	24129437, 32153512, 34748075	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	25232846, 28859103, 30055078, 30796847		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
oligodendroglioma	Oligodendroglioma	BEFREE	14997935		★★★★★ ★☆☆☆☆ Found in Text Mining only
Oligodendroglioma	Oligodendroglioma	Pubtator	14997935	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	GWASCAT_DG	25574825		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	BEFREE	21923761, 21990140, 22157634, 22547139		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	21923761, 21990140, 22547139		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	Pubtator	22157634	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia, Childhood	Schizophrenia	BEFREE	22547139		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia, Childhood	Schizophrenia	PSYGENET_DG	22547139		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Seizures	Seizures	Pubtator	34946857	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Speech Delay	Speech Delay	BEFREE	30796847		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	24015200		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	24015200	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Unipolar Depression	Mental Depression	BEFREE	21048971, 21923761		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Unipolar Depression	Mental Depression	PSYGENET_DG	21048971		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Well Differentiated Oligodendroglioma	Oligodendroglioma	BEFREE	14997935		★★★★★ ★☆☆☆☆ Found in Text Mining only

MYT1L (myelin transcription factor 1 like)