Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	23030
Gene name	Lysine demethylase 4B
Gene symbol	KDM4B
Synonyms (NCBI Gene)	JMJD2BMRD65TDRD14B
Chromosome	19
Chromosome location	19p13.3

244

Show/Hide all (244)

miRTarBase ID	miRNA	Experiments	Reference
MIRT018784	hsa-miR-335-5p	Microarray	18185580
MIRT040426	hsa-miR-615-3p	CLASH	23622248
MIRT038564	hsa-miR-106b-3p	CLASH	23622248
MIRT037961	hsa-miR-505-5p	CLASH	23622248
MIRT1084488	hsa-miR-1178	CLIP-seq
MIRT1084489	hsa-miR-1182	CLIP-seq
MIRT1084490	hsa-miR-1197	CLIP-seq
MIRT1084491	hsa-miR-122	CLIP-seq
MIRT1084492	hsa-miR-1237	CLIP-seq
MIRT1084493	hsa-miR-1253	CLIP-seq
MIRT1084494	hsa-miR-1256	CLIP-seq
MIRT1084495	hsa-miR-1258	CLIP-seq
MIRT1084496	hsa-miR-1267	CLIP-seq
MIRT1084497	hsa-miR-1270	CLIP-seq
MIRT1084498	hsa-miR-138	CLIP-seq
MIRT1084499	hsa-miR-1976	CLIP-seq
MIRT1084500	hsa-miR-199a-3p	CLIP-seq
MIRT1084501	hsa-miR-199b-3p	CLIP-seq
MIRT1084502	hsa-miR-214	CLIP-seq
MIRT1084503	hsa-miR-216a	CLIP-seq
MIRT1084504	hsa-miR-2467-3p	CLIP-seq
MIRT1084505	hsa-miR-2861	CLIP-seq
MIRT1084506	hsa-miR-296-5p	CLIP-seq
MIRT1084507	hsa-miR-299-5p	CLIP-seq
MIRT1084508	hsa-miR-29a	CLIP-seq
MIRT1084509	hsa-miR-29b	CLIP-seq
MIRT1084510	hsa-miR-29c	CLIP-seq
MIRT1084511	hsa-miR-3117-3p	CLIP-seq
MIRT1084512	hsa-miR-3126-5p	CLIP-seq
MIRT1084513	hsa-miR-3129-5p	CLIP-seq
MIRT1084514	hsa-miR-3131	CLIP-seq
MIRT1084515	hsa-miR-3135b	CLIP-seq
MIRT1084516	hsa-miR-3136-3p	CLIP-seq
MIRT1084517	hsa-miR-3157-5p	CLIP-seq
MIRT1084518	hsa-miR-3160-3p	CLIP-seq
MIRT1084519	hsa-miR-3180	CLIP-seq
MIRT1084520	hsa-miR-3180-3p	CLIP-seq
MIRT1084521	hsa-miR-3182	CLIP-seq
MIRT1084522	hsa-miR-3185	CLIP-seq
MIRT1084523	hsa-miR-3196	CLIP-seq
MIRT1084524	hsa-miR-3199	CLIP-seq
MIRT1084525	hsa-miR-3200-5p	CLIP-seq
MIRT1084526	hsa-miR-3617	CLIP-seq
MIRT1084527	hsa-miR-3619-5p	CLIP-seq
MIRT1084528	hsa-miR-3652	CLIP-seq
MIRT1084529	hsa-miR-3678-3p	CLIP-seq
MIRT1084530	hsa-miR-371-5p	CLIP-seq
MIRT1084531	hsa-miR-371b-5p	CLIP-seq
MIRT1084532	hsa-miR-3940-3p	CLIP-seq
MIRT1084533	hsa-miR-4269	CLIP-seq
MIRT1084534	hsa-miR-4281	CLIP-seq
MIRT1084535	hsa-miR-4299	CLIP-seq
MIRT1084536	hsa-miR-4303	CLIP-seq
MIRT1084537	hsa-miR-4419a	CLIP-seq
MIRT1084538	hsa-miR-4423-5p	CLIP-seq
MIRT1084539	hsa-miR-4430	CLIP-seq
MIRT1084540	hsa-miR-4436b-3p	CLIP-seq
MIRT1084541	hsa-miR-4481	CLIP-seq
MIRT1084542	hsa-miR-4487	CLIP-seq
MIRT1084543	hsa-miR-4493	CLIP-seq
MIRT1084544	hsa-miR-4504	CLIP-seq
MIRT1084545	hsa-miR-4510	CLIP-seq
MIRT1084546	hsa-miR-4530	CLIP-seq
MIRT1084547	hsa-miR-4531	CLIP-seq
MIRT1084548	hsa-miR-4532	CLIP-seq
MIRT1084549	hsa-miR-4650-5p	CLIP-seq
MIRT1084550	hsa-miR-4652-5p	CLIP-seq
MIRT1084551	hsa-miR-4655-5p	CLIP-seq
MIRT1084552	hsa-miR-4666-5p	CLIP-seq
MIRT1084553	hsa-miR-4675	CLIP-seq
MIRT1084554	hsa-miR-4690-5p	CLIP-seq
MIRT1084555	hsa-miR-4691-3p	CLIP-seq
MIRT1084556	hsa-miR-4710	CLIP-seq
MIRT1084557	hsa-miR-4722-3p	CLIP-seq
MIRT1084558	hsa-miR-4724-3p	CLIP-seq
MIRT1084559	hsa-miR-4733-3p	CLIP-seq
MIRT1084560	hsa-miR-4741	CLIP-seq
MIRT1084561	hsa-miR-4745-5p	CLIP-seq
MIRT1084562	hsa-miR-4756-3p	CLIP-seq
MIRT1084563	hsa-miR-4761-3p	CLIP-seq
MIRT1084564	hsa-miR-4763-5p	CLIP-seq
MIRT1084565	hsa-miR-4792	CLIP-seq
MIRT1084566	hsa-miR-4797-3p	CLIP-seq
MIRT1084567	hsa-miR-4797-5p	CLIP-seq
MIRT1084568	hsa-miR-4802-3p	CLIP-seq
MIRT1084569	hsa-miR-558	CLIP-seq
MIRT1084570	hsa-miR-611	CLIP-seq
MIRT1084571	hsa-miR-620	CLIP-seq
MIRT1084572	hsa-miR-641	CLIP-seq
MIRT1084573	hsa-miR-661	CLIP-seq
MIRT1084574	hsa-miR-663b	CLIP-seq
MIRT1084575	hsa-miR-720	CLIP-seq
MIRT1084576	hsa-miR-759	CLIP-seq
MIRT1084577	hsa-miR-761	CLIP-seq
MIRT1084578	hsa-miR-889	CLIP-seq
MIRT1084579	hsa-miR-936	CLIP-seq
MIRT1084580	hsa-miR-938	CLIP-seq
MIRT1084489	hsa-miR-1182	CLIP-seq
MIRT2021447	hsa-miR-1184	CLIP-seq
MIRT1084491	hsa-miR-122	CLIP-seq
MIRT2021448	hsa-miR-1224-3p	CLIP-seq
MIRT2021449	hsa-miR-1234	CLIP-seq
MIRT2021450	hsa-miR-1260	CLIP-seq
MIRT2021451	hsa-miR-1260b	CLIP-seq
MIRT1084496	hsa-miR-1267	CLIP-seq
MIRT2021452	hsa-miR-1280	CLIP-seq
MIRT2021453	hsa-miR-1301	CLIP-seq
MIRT2021454	hsa-miR-140-3p	CLIP-seq
MIRT1084507	hsa-miR-299-5p	CLIP-seq
MIRT2021455	hsa-miR-3124-3p	CLIP-seq
MIRT1084515	hsa-miR-3135b	CLIP-seq
MIRT1084518	hsa-miR-3160-3p	CLIP-seq
MIRT2021456	hsa-miR-3194-3p	CLIP-seq
MIRT1084525	hsa-miR-3200-5p	CLIP-seq
MIRT2021457	hsa-miR-361-3p	CLIP-seq
MIRT2021458	hsa-miR-3615	CLIP-seq
MIRT2021459	hsa-miR-3649	CLIP-seq
MIRT1084528	hsa-miR-3652	CLIP-seq
MIRT2021460	hsa-miR-3689d	CLIP-seq
MIRT2021461	hsa-miR-3690	CLIP-seq
MIRT2021462	hsa-miR-378	CLIP-seq
MIRT2021463	hsa-miR-378b	CLIP-seq
MIRT2021464	hsa-miR-378c	CLIP-seq
MIRT2021465	hsa-miR-378d	CLIP-seq
MIRT2021466	hsa-miR-378e	CLIP-seq
MIRT2021467	hsa-miR-378f	CLIP-seq
MIRT2021468	hsa-miR-378h	CLIP-seq
MIRT2021469	hsa-miR-378i	CLIP-seq
MIRT2021470	hsa-miR-3944-5p	CLIP-seq
MIRT2021471	hsa-miR-422a	CLIP-seq
MIRT2021472	hsa-miR-4254	CLIP-seq
MIRT2021473	hsa-miR-4256	CLIP-seq
MIRT2021474	hsa-miR-4282	CLIP-seq
MIRT2021475	hsa-miR-4292	CLIP-seq
MIRT1084536	hsa-miR-4303	CLIP-seq
MIRT2021476	hsa-miR-4308	CLIP-seq
MIRT2021477	hsa-miR-4418	CLIP-seq
MIRT1084538	hsa-miR-4423-5p	CLIP-seq
MIRT1084539	hsa-miR-4430	CLIP-seq
MIRT1084541	hsa-miR-4481	CLIP-seq
MIRT1084542	hsa-miR-4487	CLIP-seq
MIRT1084551	hsa-miR-4655-5p	CLIP-seq
MIRT2021478	hsa-miR-4660	CLIP-seq
MIRT1084553	hsa-miR-4675	CLIP-seq
MIRT2021479	hsa-miR-4714-3p	CLIP-seq
MIRT2021480	hsa-miR-4722-5p	CLIP-seq
MIRT2021481	hsa-miR-4740-3p	CLIP-seq
MIRT1084560	hsa-miR-4741	CLIP-seq
MIRT1084561	hsa-miR-4745-5p	CLIP-seq
MIRT2021482	hsa-miR-4753-3p	CLIP-seq
MIRT2021483	hsa-miR-4757-5p	CLIP-seq
MIRT1084564	hsa-miR-4763-5p	CLIP-seq
MIRT2021484	hsa-miR-4768-3p	CLIP-seq
MIRT1084567	hsa-miR-4797-5p	CLIP-seq
MIRT2021485	hsa-miR-486-3p	CLIP-seq
MIRT2021486	hsa-miR-5047	CLIP-seq
MIRT2021487	hsa-miR-509-3-5p	CLIP-seq
MIRT2021488	hsa-miR-509-5p	CLIP-seq
MIRT2021489	hsa-miR-532-3p	CLIP-seq
MIRT1084569	hsa-miR-558	CLIP-seq
MIRT2021490	hsa-miR-574-5p	CLIP-seq
MIRT2021491	hsa-miR-648	CLIP-seq
MIRT1084573	hsa-miR-661	CLIP-seq
MIRT1084575	hsa-miR-720	CLIP-seq
MIRT1084580	hsa-miR-938	CLIP-seq
MIRT1084489	hsa-miR-1182	CLIP-seq
MIRT1084491	hsa-miR-122	CLIP-seq
MIRT2021448	hsa-miR-1224-3p	CLIP-seq
MIRT2252971	hsa-miR-1228	CLIP-seq
MIRT2021450	hsa-miR-1260	CLIP-seq
MIRT2021451	hsa-miR-1260b	CLIP-seq
MIRT1084496	hsa-miR-1267	CLIP-seq
MIRT2021452	hsa-miR-1280	CLIP-seq
MIRT2021454	hsa-miR-140-3p	CLIP-seq
MIRT2252972	hsa-miR-1539	CLIP-seq
MIRT1084499	hsa-miR-1976	CLIP-seq
MIRT2252973	hsa-miR-3123	CLIP-seq
MIRT1084514	hsa-miR-3131	CLIP-seq
MIRT1084515	hsa-miR-3135b	CLIP-seq
MIRT2252974	hsa-miR-3193	CLIP-seq
MIRT2021456	hsa-miR-3194-3p	CLIP-seq
MIRT1084525	hsa-miR-3200-5p	CLIP-seq
MIRT2252975	hsa-miR-342-5p	CLIP-seq
MIRT2252976	hsa-miR-3646	CLIP-seq
MIRT2021459	hsa-miR-3649	CLIP-seq
MIRT1084528	hsa-miR-3652	CLIP-seq
MIRT2021460	hsa-miR-3689d	CLIP-seq
MIRT2252977	hsa-miR-3919	CLIP-seq
MIRT2021473	hsa-miR-4256	CLIP-seq
MIRT2252978	hsa-miR-4268	CLIP-seq
MIRT2252979	hsa-miR-4330	CLIP-seq
MIRT1084538	hsa-miR-4423-5p	CLIP-seq
MIRT1084539	hsa-miR-4430	CLIP-seq
MIRT2252980	hsa-miR-4435	CLIP-seq
MIRT2252981	hsa-miR-4448	CLIP-seq
MIRT2252982	hsa-miR-4656	CLIP-seq
MIRT2252983	hsa-miR-4664-5p	CLIP-seq
MIRT1084553	hsa-miR-4675	CLIP-seq
MIRT2021481	hsa-miR-4740-3p	CLIP-seq
MIRT1084560	hsa-miR-4741	CLIP-seq
MIRT1084562	hsa-miR-4756-3p	CLIP-seq
MIRT1084567	hsa-miR-4797-5p	CLIP-seq
MIRT2252984	hsa-miR-488	CLIP-seq
MIRT2021489	hsa-miR-532-3p	CLIP-seq
MIRT2252985	hsa-miR-552	CLIP-seq
MIRT1084570	hsa-miR-611	CLIP-seq
MIRT1084575	hsa-miR-720	CLIP-seq
MIRT2252986	hsa-miR-764	CLIP-seq
MIRT2252987	hsa-miR-933	CLIP-seq
MIRT1084580	hsa-miR-938	CLIP-seq
MIRT1084551	hsa-miR-4655-5p	CLIP-seq
MIRT1084553	hsa-miR-4675	CLIP-seq
MIRT1084560	hsa-miR-4741	CLIP-seq
MIRT1084489	hsa-miR-1182	CLIP-seq
MIRT1084491	hsa-miR-122	CLIP-seq
MIRT1084496	hsa-miR-1267	CLIP-seq
MIRT1084515	hsa-miR-3135b	CLIP-seq
MIRT1084528	hsa-miR-3652	CLIP-seq
MIRT1084538	hsa-miR-4423-5p	CLIP-seq
MIRT1084539	hsa-miR-4430	CLIP-seq
MIRT1084575	hsa-miR-720	CLIP-seq
MIRT1084489	hsa-miR-1182	CLIP-seq
MIRT1084496	hsa-miR-1267	CLIP-seq
MIRT1084515	hsa-miR-3135b	CLIP-seq
MIRT1084528	hsa-miR-3652	CLIP-seq
MIRT1084538	hsa-miR-4423-5p	CLIP-seq
MIRT1084539	hsa-miR-4430	CLIP-seq
MIRT1084575	hsa-miR-720	CLIP-seq
MIRT1084489	hsa-miR-1182	CLIP-seq
MIRT1084491	hsa-miR-122	CLIP-seq
MIRT1084496	hsa-miR-1267	CLIP-seq
MIRT1084515	hsa-miR-3135b	CLIP-seq
MIRT1084528	hsa-miR-3652	CLIP-seq
MIRT1084538	hsa-miR-4423-5p	CLIP-seq
MIRT1084539	hsa-miR-4430	CLIP-seq
MIRT1084575	hsa-miR-720	CLIP-seq
MIRT1084489	hsa-miR-1182	CLIP-seq
MIRT1084491	hsa-miR-122	CLIP-seq
MIRT1084496	hsa-miR-1267	CLIP-seq
MIRT1084515	hsa-miR-3135b	CLIP-seq
MIRT1084528	hsa-miR-3652	CLIP-seq
MIRT1084538	hsa-miR-4423-5p	CLIP-seq
MIRT1084539	hsa-miR-4430	CLIP-seq
MIRT1084575	hsa-miR-720	CLIP-seq

Show/Hide all (20)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	IBA
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0006325	Process	Chromatin organization	IEA
GO:0006338	Process	Chromatin remodeling	IBA
GO:0007420	Process	Brain development	ISS
GO:0008270	Function	Zinc ion binding	IEA
GO:0010468	Process	Regulation of gene expression	IBA
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0032452	Function	Histone demethylase activity	TAS
GO:0032454	Function	Histone H3K9 demethylase activity	IBA
GO:0032454	Function	Histone H3K9 demethylase activity	IMP	28262558
GO:0032454	Function	Histone H3K9 demethylase activity	TAS
GO:0046872	Function	Metal ion binding	IEA
GO:0051213	Function	Dioxygenase activity	IEA
GO:0051864	Function	Histone H3K36 demethylase activity	IDA	21914792
GO:0051864	Function	Histone H3K36 demethylase activity	IEA
GO:0140684	Function	Histone H3K9me2/H3K9me3 demethylase activity	IDA	21914792
GO:0140684	Function	Histone H3K9me2/H3K9me3 demethylase activity	IEA

MIM	HGNC	e!Ensembl
609765	29136	ENSG00000127663

O94953

Protein name

Lysine-specific demethylase 4B (EC 1.14.11.66) (JmjC domain-containing histone demethylation protein 3B) (Jumonji domain-containing protein 2B) ([histone H3]-trimethyl-L-lysine(9) demethylase 4B)

Protein function

Histone demethylase that specifically demethylates 'Lys-9' of histone H3, thereby playing a role in histone code. Does not demethylate histone H3 'Lys-4', H3 'Lys-27', H3 'Lys-36' nor H4 'Lys-20'. Only able to demethylate trimethylated H3 'Lys-9

PDB

4LXL , 4UC4 , 7JM5 , 9H44

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02375	JmjN	16 → 50	jmjN domain	Family
PF02373	JmjC	176 → 292	JmjC domain, hydroxylase	Domain
PF13831	PHD_2	754 → 789		Family
PF13832	zf-HC5HC2H_2	795 → 906		Domain
PF18104	Tudor_2	922 → 956	Jumonji domain-containing protein 2A Tudor domain	Domain
PF18104	Tudor_2	980 → 1014	Jumonji domain-containing protein 2A Tudor domain	Domain

Sequence

MGSEDHGAQNPSCKIMTFRPTMEEFKDFNKYVAYIESQGAHRAGLAKIIPPKEWKPRQTY
DDIDDVVIPAPIQQVVTGQSGLFTQYNIQKKAMTVGEYRRLANSEKYCTPRHQDFDDLER
KYWKNLTFVSPIYGADISGSLYDDDVAQWNIGSLRTILDMVERECGTIIEGVNTPYLYFG
MWKTTFAWHTEDMDLYSINYLHFGEPKSWYAIPPEHGKRLERLAIGFFPGSSQGCDAFLR
HKMTLISPIILKKYGIPFSRITQEAGEFMITFPYGYHAGFNHGFNCAESTNFATLRWIDY
GKVATQCTCRKDMVKISMDVFVRILQPERYELWKQGKDLTVLDHTRPTALTSPELSSWSA
SRASLKAKLLRRSHRKRSQPKKPKPEDPKFPGEGTAGAALLEEAGGSVKEEAGPEVDPEE
EEEEPQPLPHGREAEGAEEDGRGKLRPTKAKSERKKKSFGLLPPQLPPPPAHFPSEEALW
LPSPLEPPVLGPGPAAMEESPLPAPLNVVPPEVPSEELEAKPRPIIPMLYVVPRPGKAAF
NQEHVSCQQAFEHFAQKGPTWKEPVSPMELTGPEDGAASSGAGRMETKARAGEGQAPSTF
SKLKMEIKKSRRHPLGRPPTRSPLSVVKQEASSDEEASPFSGEEDVSDPDALRPLLSLQW
KNRAASFQAERKFNAAAARTEPYCAICTLFYPYCQALQTEKEAPIASLGKGCPATLPSKS
RQKTRPLIPEMCFTSGGENTEPLPANSYIGDDGTSPLIACGKCCLQVHASCYGIRPELVN
EGWTCSRCAAHAWTAECCLCNLRGGALQMTTDRRWIHVICAIAVPEARFLNVIERHPVDI
SAIPEQRWKLKCVYCRKRMKKVSGACIQCSYEHCSTSFHVTCAHAAGVLMEPDDWPYVVS
ITCLKHKSGGHAVQLLRAVSLGQVVITKNRNGLYYRCRVIGAASQTCYEVNFDDGSYSDN
LYPESITSRDCVQLGPPSEGELVELRWTDGNLYKAKFISSVTSHIYQVEFEDGSQLTVKR
GDIFTLEEELPKRVRSRLSLSTGAPQEPAFSGEEAKAAKRPRVGTPLATEDSGRSQDYVA
FVESLLQVQGRPGAPF

Sequence length

1096

Interactions

View interactions

	Reactome
			HDMs demethylate histones Recruitment and ATM-mediated phosphorylation of repair and signaling proteins at DNA double strand breaks Estrogen-dependent gene expression

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (3)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Intellectual developmental disorder, autosomal dominant 65	Pathogenic; Likely pathogenic	rs2145822607, rs2146074788, rs2146057065, rs746714213, rs1231991589, rs2512133290, rs2512571434, rs748669919, rs2512166678, rs2512151147, rs2512130849, rs2039680672, rs2512537089, rs2512571628, rs151146933	RCV001420723 RCV001420724 RCV001420725 RCV001800248 RCV002227606 View all (10 more)	★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Neurodevelopmental delay	Likely pathogenic	rs2146060644	RCV002274350	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Neurodevelopmental disorder	Likely pathogenic	rs2146018043	RCV002277638	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (30)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATRIAL FIBRILLATION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholangiocarcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEVELOPMENTAL DISABILITIES	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Developmental disorder	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GOUT	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KDM4B-related disorder	Conflicting classifications of pathogenicity; Uncertain significance; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MEDULLOBLASTOMA	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MELANOMA	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neurodevelopmental abnormality	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEURODEVELOPMENTAL DISORDERS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-SPECIFIC SYNDROMIC INTELLECTUAL DISABILITY	—	Disgenet, Orphanet Disgenet, Orphanet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PERIODONTITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RESTLESS LEGS SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SUBSTANCE ABUSE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Syndromic global developmental delay	Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC LUPUS ERYTHEMATOSUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thymoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine carcinosarcoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (62)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma	Adenocarcinoma	BEFREE	24481461		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	27630338		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	CTD_human_DG	19270706		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	33909202	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	33688506	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	20682797, 21445275, 25725194, 30266800, 30418174, 30459150, 31390833		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	20682797, 23723241, 25725194	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	30683841, 31647098	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	27487123	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	21930796, 27630338		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	36952476	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	27869162		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervical Intraepithelial Neoplasia	Cervical Intraepithelial Neoplasia	BEFREE	22081068		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	CTD_human_DG	19270706		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	28945223		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	22345654, 24473398, 24957706, 29633065		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	BEFREE	24481461		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	26511091	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Desmoplastic Medulloblastoma	Medulloblastoma	CTD_human_DG	19270706		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	26397136		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	27869162		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	30214048		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	38093312	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	21502505	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperlipidemia	Hyperlipidemia	BEFREE	29844188		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	18984585, 20682797	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	18984585	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	27487123		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	GWASCAT_DG	28714469		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	20682797, 21445275, 25725194, 30266800, 30418174, 30459150, 31390833		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	26397136		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	21930796, 27630338		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	27869162		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	23435229, 24200674, 26364928, 31468537		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	22133676, 24077348, 29511447, 30485532		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	21930796		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	21930796, 23046878, 23435229, 24473398, 27487123, 29342868, 30459150, 30485532, 30759871		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	28945223		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	21445275, 22081068		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	CTD_human_DG	19270706		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Medullomyoblastoma	Medullomyoblastoma	CTD_human_DG	19270706		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	CTD_human_DG	29438700		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanotic medulloblastoma	Medulloblastoma	CTD_human_DG	19270706		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Bone Disorder	Metabolic Bone Disorder	BEFREE	22770241		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	21445275, 22133676, 22345654, 24077348, 24473398, 25593028, 26364928, 27487123, 27869162, 28073943, 28945223, 29633065, 30459150		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	25925418		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	30967636		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	29844188, 30073721		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	22770241		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	25636512		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	32802732	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	27869162		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	26511091	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Periodontal Diseases	BEFREE	29927684		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	23435229, 24200674, 26364928, 31468537		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	24971742, 34417538	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	Pubtator	35857643	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	30214048		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	22133676, 24077348, 29511447, 30485532		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	30683841	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	30266800		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal melanoma	Pubtator	25593028	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

KDM4B (lysine demethylase 4B)