Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	23017
Gene name	Fas apoptotic inhibitory molecule 2
Gene symbol	FAIM2
Synonyms (NCBI Gene)	LFGLFG2NGP35NMP35TMBIM2
Chromosome	12
Chromosome location	12q13.12

292

Show/Hide all (292)

miRTarBase ID	miRNA	Experiments	Reference
MIRT647646	hsa-miR-4267	HITS-CLIP	23824327
MIRT647645	hsa-miR-875-3p	HITS-CLIP	23824327
MIRT647644	hsa-miR-6128	HITS-CLIP	23824327
MIRT647643	hsa-miR-3655	HITS-CLIP	23824327
MIRT647642	hsa-miR-6778-3p	HITS-CLIP	23824327
MIRT647641	hsa-miR-6791-3p	HITS-CLIP	23824327
MIRT647640	hsa-miR-6829-3p	HITS-CLIP	23824327
MIRT647639	hsa-miR-7977	HITS-CLIP	23824327
MIRT647638	hsa-miR-1299	HITS-CLIP	23824327
MIRT647637	hsa-miR-6836-3p	HITS-CLIP	23824327
MIRT647636	hsa-miR-4288	HITS-CLIP	23824327
MIRT647635	hsa-miR-632	HITS-CLIP	23824327
MIRT647634	hsa-miR-1231	HITS-CLIP	23824327
MIRT647633	hsa-miR-3152-5p	HITS-CLIP	23824327
MIRT647646	hsa-miR-4267	HITS-CLIP	23824327
MIRT647645	hsa-miR-875-3p	HITS-CLIP	23824327
MIRT647644	hsa-miR-6128	HITS-CLIP	23824327
MIRT647643	hsa-miR-3655	HITS-CLIP	23824327
MIRT647642	hsa-miR-6778-3p	HITS-CLIP	23824327
MIRT647641	hsa-miR-6791-3p	HITS-CLIP	23824327
MIRT647640	hsa-miR-6829-3p	HITS-CLIP	23824327
MIRT647639	hsa-miR-7977	HITS-CLIP	23824327
MIRT647638	hsa-miR-1299	HITS-CLIP	23824327
MIRT647637	hsa-miR-6836-3p	HITS-CLIP	23824327
MIRT647636	hsa-miR-4288	HITS-CLIP	23824327
MIRT647635	hsa-miR-632	HITS-CLIP	23824327
MIRT647634	hsa-miR-1231	HITS-CLIP	23824327
MIRT647633	hsa-miR-3152-5p	HITS-CLIP	23824327
MIRT975361	hsa-miR-1207-3p	CLIP-seq
MIRT975362	hsa-miR-1228	CLIP-seq
MIRT975363	hsa-miR-1229	CLIP-seq
MIRT975364	hsa-miR-1252	CLIP-seq
MIRT975365	hsa-miR-1253	CLIP-seq
MIRT975366	hsa-miR-1254	CLIP-seq
MIRT975367	hsa-miR-128	CLIP-seq
MIRT975368	hsa-miR-1286	CLIP-seq
MIRT975369	hsa-miR-1291	CLIP-seq
MIRT975370	hsa-miR-1343	CLIP-seq
MIRT975371	hsa-miR-146a	CLIP-seq
MIRT975372	hsa-miR-146b-5p	CLIP-seq
MIRT975373	hsa-miR-1827	CLIP-seq
MIRT975374	hsa-miR-185	CLIP-seq
MIRT975375	hsa-miR-1908	CLIP-seq
MIRT975376	hsa-miR-1915	CLIP-seq
MIRT975377	hsa-miR-193a-3p	CLIP-seq
MIRT975378	hsa-miR-193a-5p	CLIP-seq
MIRT975379	hsa-miR-193b	CLIP-seq
MIRT975380	hsa-miR-1976	CLIP-seq
MIRT975381	hsa-miR-22	CLIP-seq
MIRT975382	hsa-miR-2278	CLIP-seq
MIRT975383	hsa-miR-28-5p	CLIP-seq
MIRT975384	hsa-miR-3064-5p	CLIP-seq
MIRT975385	hsa-miR-3116	CLIP-seq
MIRT975386	hsa-miR-3119	CLIP-seq
MIRT975387	hsa-miR-3121-5p	CLIP-seq
MIRT975388	hsa-miR-3126-5p	CLIP-seq
MIRT975389	hsa-miR-3135b	CLIP-seq
MIRT975390	hsa-miR-3139	CLIP-seq
MIRT975391	hsa-miR-3148	CLIP-seq
MIRT975392	hsa-miR-3150b-3p	CLIP-seq
MIRT975393	hsa-miR-3157-3p	CLIP-seq
MIRT975394	hsa-miR-3199	CLIP-seq
MIRT975395	hsa-miR-3202	CLIP-seq
MIRT975396	hsa-miR-328	CLIP-seq
MIRT975397	hsa-miR-329	CLIP-seq
MIRT975398	hsa-miR-362-3p	CLIP-seq
MIRT975399	hsa-miR-3649	CLIP-seq
MIRT975400	hsa-miR-3656	CLIP-seq
MIRT975401	hsa-miR-3663-3p	CLIP-seq
MIRT975402	hsa-miR-3688-3p	CLIP-seq
MIRT975403	hsa-miR-3688-5p	CLIP-seq
MIRT975404	hsa-miR-3925-3p	CLIP-seq
MIRT975405	hsa-miR-3945	CLIP-seq
MIRT975406	hsa-miR-4253	CLIP-seq
MIRT975407	hsa-miR-4270	CLIP-seq
MIRT975408	hsa-miR-4303	CLIP-seq
MIRT975409	hsa-miR-4306	CLIP-seq
MIRT975410	hsa-miR-4434	CLIP-seq
MIRT975411	hsa-miR-4441	CLIP-seq
MIRT975412	hsa-miR-4446-5p	CLIP-seq
MIRT975413	hsa-miR-4466	CLIP-seq
MIRT975414	hsa-miR-4492	CLIP-seq
MIRT975415	hsa-miR-4498	CLIP-seq
MIRT975416	hsa-miR-4505	CLIP-seq
MIRT975417	hsa-miR-4515	CLIP-seq
MIRT975418	hsa-miR-4516	CLIP-seq
MIRT975419	hsa-miR-4531	CLIP-seq
MIRT975420	hsa-miR-4533	CLIP-seq
MIRT975421	hsa-miR-4633-3p	CLIP-seq
MIRT975422	hsa-miR-4638-5p	CLIP-seq
MIRT975423	hsa-miR-4644	CLIP-seq
MIRT975424	hsa-miR-4646-5p	CLIP-seq
MIRT975425	hsa-miR-4649-3p	CLIP-seq
MIRT975426	hsa-miR-4656	CLIP-seq
MIRT975427	hsa-miR-4680-3p	CLIP-seq
MIRT975428	hsa-miR-4704-3p	CLIP-seq
MIRT975429	hsa-miR-4722-5p	CLIP-seq
MIRT975430	hsa-miR-4726-3p	CLIP-seq
MIRT975431	hsa-miR-4733-5p	CLIP-seq
MIRT975432	hsa-miR-4747-5p	CLIP-seq
MIRT975433	hsa-miR-4753-5p	CLIP-seq
MIRT975434	hsa-miR-4754	CLIP-seq
MIRT975435	hsa-miR-4755-5p	CLIP-seq
MIRT975436	hsa-miR-4757-5p	CLIP-seq
MIRT975437	hsa-miR-4762-3p	CLIP-seq
MIRT975438	hsa-miR-4779	CLIP-seq
MIRT975439	hsa-miR-4784	CLIP-seq
MIRT975440	hsa-miR-483-5p	CLIP-seq
MIRT975441	hsa-miR-532-5p	CLIP-seq
MIRT975442	hsa-miR-548a-3p	CLIP-seq
MIRT975443	hsa-miR-548ae	CLIP-seq
MIRT975444	hsa-miR-548aj	CLIP-seq
MIRT975445	hsa-miR-548am	CLIP-seq
MIRT975446	hsa-miR-548e	CLIP-seq
MIRT975447	hsa-miR-548f	CLIP-seq
MIRT975448	hsa-miR-548x	CLIP-seq
MIRT975449	hsa-miR-552	CLIP-seq
MIRT975450	hsa-miR-610	CLIP-seq
MIRT975451	hsa-miR-634	CLIP-seq
MIRT975452	hsa-miR-642a	CLIP-seq
MIRT975453	hsa-miR-661	CLIP-seq
MIRT975454	hsa-miR-663	CLIP-seq
MIRT975455	hsa-miR-675	CLIP-seq
MIRT975456	hsa-miR-708	CLIP-seq
MIRT975457	hsa-miR-762	CLIP-seq
MIRT975458	hsa-miR-764	CLIP-seq
MIRT975459	hsa-miR-765	CLIP-seq
MIRT975460	hsa-miR-766	CLIP-seq
MIRT975461	hsa-miR-873	CLIP-seq
MIRT975462	hsa-miR-874	CLIP-seq
MIRT975463	hsa-miR-885-3p	CLIP-seq
MIRT975464	hsa-miR-890	CLIP-seq
MIRT975465	hsa-miR-938	CLIP-seq
MIRT1548473	hsa-miR-3661	CLIP-seq
MIRT1548474	hsa-miR-631	CLIP-seq
MIRT975361	hsa-miR-1207-3p	CLIP-seq
MIRT975370	hsa-miR-1343	CLIP-seq
MIRT975374	hsa-miR-185	CLIP-seq
MIRT975384	hsa-miR-3064-5p	CLIP-seq
MIRT1989066	hsa-miR-3175	CLIP-seq
MIRT1989067	hsa-miR-3667-3p	CLIP-seq
MIRT975409	hsa-miR-4306	CLIP-seq
MIRT975414	hsa-miR-4492	CLIP-seq
MIRT975415	hsa-miR-4498	CLIP-seq
MIRT975416	hsa-miR-4505	CLIP-seq
MIRT975423	hsa-miR-4644	CLIP-seq
MIRT1989068	hsa-miR-4793-5p	CLIP-seq
MIRT975457	hsa-miR-762	CLIP-seq
MIRT2223498	hsa-miR-105	CLIP-seq
MIRT2223499	hsa-miR-106a	CLIP-seq
MIRT2223500	hsa-miR-106b	CLIP-seq
MIRT2223501	hsa-miR-1197	CLIP-seq
MIRT2223502	hsa-miR-1243	CLIP-seq
MIRT975366	hsa-miR-1254	CLIP-seq
MIRT2223503	hsa-miR-1323	CLIP-seq
MIRT2223504	hsa-miR-17	CLIP-seq
MIRT2223505	hsa-miR-1912	CLIP-seq
MIRT2223506	hsa-miR-20a	CLIP-seq
MIRT2223507	hsa-miR-20b	CLIP-seq
MIRT2223508	hsa-miR-2276	CLIP-seq
MIRT975385	hsa-miR-3116	CLIP-seq
MIRT2223509	hsa-miR-3150a-3p	CLIP-seq
MIRT975392	hsa-miR-3150b-3p	CLIP-seq
MIRT1989066	hsa-miR-3175	CLIP-seq
MIRT2223510	hsa-miR-3187-3p	CLIP-seq
MIRT2223511	hsa-miR-3616-3p	CLIP-seq
MIRT2223512	hsa-miR-3671	CLIP-seq
MIRT2223513	hsa-miR-4252	CLIP-seq
MIRT2223514	hsa-miR-4254	CLIP-seq
MIRT2223515	hsa-miR-4266	CLIP-seq
MIRT2223516	hsa-miR-4435	CLIP-seq
MIRT2223517	hsa-miR-4436a	CLIP-seq
MIRT2223518	hsa-miR-4436b-3p	CLIP-seq
MIRT2223519	hsa-miR-4463	CLIP-seq
MIRT975414	hsa-miR-4492	CLIP-seq
MIRT2223520	hsa-miR-4494	CLIP-seq
MIRT975415	hsa-miR-4498	CLIP-seq
MIRT2223521	hsa-miR-4504	CLIP-seq
MIRT975416	hsa-miR-4505	CLIP-seq
MIRT975425	hsa-miR-4649-3p	CLIP-seq
MIRT2223522	hsa-miR-4653-3p	CLIP-seq
MIRT2223523	hsa-miR-4679	CLIP-seq
MIRT2223524	hsa-miR-4687-3p	CLIP-seq
MIRT2223525	hsa-miR-4689	CLIP-seq
MIRT2223526	hsa-miR-4691-3p	CLIP-seq
MIRT2223527	hsa-miR-4695-5p	CLIP-seq
MIRT2223528	hsa-miR-4701-5p	CLIP-seq
MIRT2223529	hsa-miR-4715-5p	CLIP-seq
MIRT975429	hsa-miR-4722-5p	CLIP-seq
MIRT2223530	hsa-miR-4772-3p	CLIP-seq
MIRT975438	hsa-miR-4779	CLIP-seq
MIRT975439	hsa-miR-4784	CLIP-seq
MIRT2223531	hsa-miR-485-5p	CLIP-seq
MIRT2223532	hsa-miR-519d	CLIP-seq
MIRT2223533	hsa-miR-520g	CLIP-seq
MIRT2223534	hsa-miR-520h	CLIP-seq
MIRT2223535	hsa-miR-542-3p	CLIP-seq
MIRT2223536	hsa-miR-544	CLIP-seq
MIRT2223537	hsa-miR-545	CLIP-seq
MIRT2223538	hsa-miR-548o	CLIP-seq
MIRT2223539	hsa-miR-548s	CLIP-seq
MIRT2223540	hsa-miR-571	CLIP-seq
MIRT2223541	hsa-miR-588	CLIP-seq
MIRT2223542	hsa-miR-604	CLIP-seq
MIRT2223543	hsa-miR-607	CLIP-seq
MIRT2223544	hsa-miR-711	CLIP-seq
MIRT975457	hsa-miR-762	CLIP-seq
MIRT2223545	hsa-miR-93	CLIP-seq
MIRT2223546	hsa-miR-939	CLIP-seq
MIRT2387618	hsa-miR-1184	CLIP-seq
MIRT2387619	hsa-miR-1205	CLIP-seq
MIRT975366	hsa-miR-1254	CLIP-seq
MIRT2387620	hsa-miR-1301	CLIP-seq
MIRT975375	hsa-miR-1908	CLIP-seq
MIRT2387621	hsa-miR-2115	CLIP-seq
MIRT975381	hsa-miR-22	CLIP-seq
MIRT975385	hsa-miR-3116	CLIP-seq
MIRT2387622	hsa-miR-3158-5p	CLIP-seq
MIRT1989066	hsa-miR-3175	CLIP-seq
MIRT2387623	hsa-miR-3176	CLIP-seq
MIRT2387624	hsa-miR-3180-5p	CLIP-seq
MIRT2387625	hsa-miR-342-5p	CLIP-seq
MIRT975400	hsa-miR-3656	CLIP-seq
MIRT975403	hsa-miR-3688-5p	CLIP-seq
MIRT2387626	hsa-miR-3922-3p	CLIP-seq
MIRT2387627	hsa-miR-4283	CLIP-seq
MIRT975410	hsa-miR-4434	CLIP-seq
MIRT2387628	hsa-miR-4481	CLIP-seq
MIRT2387629	hsa-miR-4489	CLIP-seq
MIRT975418	hsa-miR-4516	CLIP-seq
MIRT975419	hsa-miR-4531	CLIP-seq
MIRT2387630	hsa-miR-4651	CLIP-seq
MIRT2387631	hsa-miR-4660	CLIP-seq
MIRT2387632	hsa-miR-4664-5p	CLIP-seq
MIRT2387633	hsa-miR-4693-3p	CLIP-seq
MIRT2387634	hsa-miR-4731-5p	CLIP-seq
MIRT2387635	hsa-miR-4745-5p	CLIP-seq
MIRT2223531	hsa-miR-485-5p	CLIP-seq
MIRT2387636	hsa-miR-5047	CLIP-seq
MIRT2387637	hsa-miR-520a-5p	CLIP-seq
MIRT2387638	hsa-miR-525-5p	CLIP-seq
MIRT2387639	hsa-miR-608	CLIP-seq
MIRT2387640	hsa-miR-644	CLIP-seq
MIRT975453	hsa-miR-661	CLIP-seq
MIRT975454	hsa-miR-663	CLIP-seq
MIRT975463	hsa-miR-885-3p	CLIP-seq
MIRT2527385	hsa-miR-1208	CLIP-seq
MIRT2527386	hsa-miR-1255a	CLIP-seq
MIRT2527387	hsa-miR-1255b	CLIP-seq
MIRT2527388	hsa-miR-137	CLIP-seq
MIRT2527389	hsa-miR-1470	CLIP-seq
MIRT2527390	hsa-miR-3117-5p	CLIP-seq
MIRT2527391	hsa-miR-3131	CLIP-seq
MIRT1548473	hsa-miR-3661	CLIP-seq
MIRT2527392	hsa-miR-452	CLIP-seq
MIRT2527393	hsa-miR-4667-3p	CLIP-seq
MIRT2527394	hsa-miR-4676-3p	CLIP-seq
MIRT2527395	hsa-miR-4751	CLIP-seq
MIRT2527396	hsa-miR-492	CLIP-seq
MIRT2527397	hsa-miR-539	CLIP-seq
MIRT2527398	hsa-miR-611	CLIP-seq
MIRT2527399	hsa-miR-619	CLIP-seq
MIRT1548474	hsa-miR-631	CLIP-seq
MIRT975361	hsa-miR-1207-3p	CLIP-seq
MIRT2527386	hsa-miR-1255a	CLIP-seq
MIRT2527387	hsa-miR-1255b	CLIP-seq
MIRT2527389	hsa-miR-1470	CLIP-seq
MIRT2223505	hsa-miR-1912	CLIP-seq
MIRT2527391	hsa-miR-3131	CLIP-seq
MIRT2680449	hsa-miR-331-3p	CLIP-seq
MIRT2680450	hsa-miR-33a	CLIP-seq
MIRT2680451	hsa-miR-33b	CLIP-seq
MIRT2680452	hsa-miR-361-3p	CLIP-seq
MIRT1548473	hsa-miR-3661	CLIP-seq
MIRT2680453	hsa-miR-3664-3p	CLIP-seq
MIRT1989067	hsa-miR-3667-3p	CLIP-seq
MIRT2223515	hsa-miR-4266	CLIP-seq
MIRT2223517	hsa-miR-4436a	CLIP-seq
MIRT2527393	hsa-miR-4667-3p	CLIP-seq
MIRT2223527	hsa-miR-4695-5p	CLIP-seq
MIRT2680454	hsa-miR-4715-3p	CLIP-seq
MIRT2527395	hsa-miR-4751	CLIP-seq
MIRT975438	hsa-miR-4779	CLIP-seq
MIRT2223531	hsa-miR-485-5p	CLIP-seq
MIRT2527396	hsa-miR-492	CLIP-seq
MIRT2527397	hsa-miR-539	CLIP-seq
MIRT2527398	hsa-miR-611	CLIP-seq
MIRT2527399	hsa-miR-619	CLIP-seq
MIRT1548474	hsa-miR-631	CLIP-seq
MIRT2223544	hsa-miR-711	CLIP-seq
MIRT2680455	hsa-miR-767-3p	CLIP-seq
MIRT975465	hsa-miR-938	CLIP-seq

Show/Hide all (36)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000139	Component	Golgi membrane	IDA	25764978
GO:0002931	Process	Response to ischemia	IEA
GO:0005262	Function	Calcium channel activity	IBA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005783	Component	Endoplasmic reticulum	IBA
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005794	Component	Golgi apparatus	IBA
GO:0005794	Component	Golgi apparatus	IEA
GO:0005886	Component	Plasma membrane	IEA
GO:0006915	Process	Apoptotic process	IEA
GO:0016020	Component	Membrane	IBA
GO:0016020	Component	Membrane	IEA
GO:0021549	Process	Cerebellum development	IEA
GO:0021549	Process	Cerebellum development	ISS
GO:0021680	Process	Cerebellar Purkinje cell layer development	IEA
GO:0021680	Process	Cerebellar Purkinje cell layer development	ISS
GO:0021681	Process	Cerebellar granular layer development	IEA
GO:0021681	Process	Cerebellar granular layer development	ISS
GO:0021702	Process	Cerebellar Purkinje cell differentiation	IEA
GO:0021702	Process	Cerebellar Purkinje cell differentiation	ISS
GO:0043066	Process	Negative regulation of apoptotic process	NAS	10535980
GO:0043523	Process	Regulation of neuron apoptotic process	IEA
GO:0043523	Process	Regulation of neuron apoptotic process	IMP	17635665
GO:0043524	Process	Negative regulation of neuron apoptotic process	IBA
GO:0043524	Process	Negative regulation of neuron apoptotic process	IEA
GO:0045121	Component	Membrane raft	IDA	17635665
GO:0045121	Component	Membrane raft	IEA
GO:0045202	Component	Synapse	IEA
GO:0045211	Component	Postsynaptic membrane	IEA
GO:0051402	Process	Neuron apoptotic process	IEA
GO:0070588	Process	Calcium ion transmembrane transport	IEA
GO:0097190	Process	Apoptotic signaling pathway	IBA
GO:0097190	Process	Apoptotic signaling pathway	IEA
GO:1902042	Process	Negative regulation of extrinsic apoptotic signaling pathway via death domain receptors	IBA
GO:1902042	Process	Negative regulation of extrinsic apoptotic signaling pathway via death domain receptors	IDA	26582200
GO:2001234	Process	Negative regulation of apoptotic signaling pathway	IEA

MIM	HGNC	e!Ensembl
604306	17067	ENSG00000135472

Q9BWQ8

Protein name

Protein lifeguard 2 (Fas apoptotic inhibitory molecule 2) (Neural membrane protein 35) (Transmembrane BAX inhibitor motif-containing protein 2)

Protein function

Antiapoptotic protein which protects cells uniquely from Fas-induced apoptosis. Regulates Fas-mediated apoptosis in neurons by interfering with caspase-8 activation. May play a role in cerebellar development by affecting cerebellar size, interna

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01027	Bax1-I	100 → 311	Inhibitor of apoptosis-promoting Bax1	Family

Tissue specificity

TISSUE SPECIFICITY: Highly expressed in breast carcinoma tissues. Enhanced expression correlates with the grade of the tumor (grade II/grade III) in primary breast tumors (at protein level). Widely expressed. Expressed at high levels in the brain especial

Sequence

MTQGKLSVANKAPGTEGQQQVHGEKKEAPAVPSAPPSYEEATSGEGMKAGAFPPAPTAVP
LHPSWAYVDPSSSSSYDNGFPTGDHELFTTFSWDDQKVRRVFVRKVYTILLIQLLVTLAV
VALFTFCDPVKDYVQANPGWYWASYAVFFATYLTLACCSGPRRHFPWNLILLTVFTLSMA
YLTGMLSSYYNTTSVLLCLGITALVCLSVTVFSFQTKFDFTSCQGVLFVLLMTLFFSGLI
LAILLPFQYVPWLHAVYAALGAGVFTLFLALDTQLLMGNRRHSLSPEEYIFGALNIYLDI
IYIFTFFLQLFGTNRE

Sequence length

316

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (6)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GOUT	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERPITUITARISM	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MORBID OBESITY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (49)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	28461245		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	33193078	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	20816195		★★★★★ ★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	28587346		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Ischemia	Cerebral Ischemia	BEFREE	29315561, 31211943		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	28454284		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	20336406	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	26398169	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	27666964, 29131440		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	28587346		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	29315561		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholelithiasis	Cholelithiasis	BEFREE	28799434		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	35999641	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	33193078	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	32228543	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	24393375		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	BEFREE	25696115		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gaucher Disease	Gaucher disease	Pubtator	33193078	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves disease	Pubtator	33193078	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto disease	Pubtator	33193078	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemihyperplasia Isolated	Hemihyperplasia	Pubtator	32003752	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	BEFREE	23090577		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	33193078	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	23588626		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	32003752	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	31211943		★★★★★ ★☆☆☆☆ Found in Text Mining only
Latent Autoimmune Diabetes in Adults	Latent autoimmune diabetes in adults	Pubtator	39337639	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	30617187		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	29131440	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	28454284		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	27666964, 29131440		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	28587346		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	24618693, 28454284		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	Pubtator	37083768	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	24269186		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	33193078	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	24393375		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	25188511, 29131440		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	25188511		★★★★★ ★☆☆☆☆ Found in Text Mining only
Niemann-Pick Disease, Type C1	Sphingomyelinase deficiency	BEFREE	19851340		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	29131440		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	19812171, 20843981, 23347264, 23924573, 24393375, 25696115, 25922107, 30202879, 32228543, 36921152, 39337639	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	BEFREE	19851340, 22041983, 23924573, 24393375, 24528214, 24621099, 25696115, 25922107, 30202879		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	GWASDB_DG	21935397		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ovarian neoplasm	Ovarian neoplasm	BEFREE	28587346		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	35370009	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	29315561		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	25735388	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroiditis Autoimmune	Thyroiditis	Pubtator	33193078	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

FAIM2 (Fas apoptotic inhibitory molecule 2)