FOXL1 (forkhead box L1)

Gene

• Entrez ID: 2300
• Gene name: Forkhead box L1
• Gene symbol: FOXL1
• Synonyms (NCBI Gene): FKH6, FKHL11, FREAC7, OTSC11
• Chromosome: 16
• Chromosome location: 16q24.1
• Summary: This gene encodes a member of the forkhead/winged helix-box (FOX) family of transcription factors. FOX transcription factors are characterized by a distinct DNA-binding forkhead domain and play critical roles in the regulation of multiple processes includ

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT509700	hsa-miR-5580-3p	HITS-CLIP	21572407
MIRT557825	hsa-miR-410-3p	HITS-CLIP	21572407
MIRT509699	hsa-miR-5011-5p	HITS-CLIP	21572407
MIRT509698	hsa-miR-190a-3p	HITS-CLIP	21572407
MIRT509697	hsa-miR-3924	HITS-CLIP	21572407
MIRT509696	hsa-miR-6516-3p	HITS-CLIP	21572407
MIRT647666	hsa-miR-4686	HITS-CLIP	23824327
MIRT647665	hsa-miR-6729-3p	HITS-CLIP	23824327
MIRT647664	hsa-miR-6892-3p	HITS-CLIP	23824327
MIRT647663	hsa-miR-2276-5p	HITS-CLIP	23824327
MIRT647662	hsa-miR-3183	HITS-CLIP	23824327
MIRT647661	hsa-miR-4723-3p	HITS-CLIP	23824327
MIRT647660	hsa-miR-6769b-3p	HITS-CLIP	23824327
MIRT647659	hsa-miR-7110-3p	HITS-CLIP	23824327
MIRT647658	hsa-miR-6817-3p	HITS-CLIP	23824327
MIRT647657	hsa-miR-6728-3p	HITS-CLIP	23824327
MIRT647656	hsa-miR-20a-3p	HITS-CLIP	23824327
MIRT647655	hsa-miR-642a-5p	HITS-CLIP	23824327
MIRT647654	hsa-miR-6873-3p	HITS-CLIP	23824327
MIRT633744	hsa-miR-8485	HITS-CLIP	23824327
MIRT633743	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT633742	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT633741	hsa-miR-603	HITS-CLIP	23824327
MIRT633740	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT633739	hsa-miR-4643	HITS-CLIP	23824327
MIRT548177	hsa-miR-181a-5p	HITS-CLIP	23824327
MIRT548176	hsa-miR-181b-5p	HITS-CLIP	23824327
MIRT548175	hsa-miR-181c-5p	HITS-CLIP	23824327
MIRT548174	hsa-miR-181d-5p	HITS-CLIP	23824327
MIRT548173	hsa-miR-4262	HITS-CLIP	23824327
MIRT633738	hsa-miR-5195-5p	HITS-CLIP	23824327
MIRT633737	hsa-miR-3941	HITS-CLIP	23824327
MIRT633736	hsa-miR-466	HITS-CLIP	23824327
MIRT509696	hsa-miR-6516-3p	HITS-CLIP	23824327
MIRT509700	hsa-miR-5580-3p	PAR-CLIP	21572407
MIRT548177	hsa-miR-181a-5p	PAR-CLIP	21572407
MIRT548176	hsa-miR-181b-5p	PAR-CLIP	21572407
MIRT548175	hsa-miR-181c-5p	PAR-CLIP	21572407
MIRT548174	hsa-miR-181d-5p	PAR-CLIP	21572407
MIRT548173	hsa-miR-4262	PAR-CLIP	21572407
MIRT557825	hsa-miR-410-3p	PAR-CLIP	21572407
MIRT509699	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT557824	hsa-miR-3177-5p	PAR-CLIP	21572407
MIRT509698	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT509697	hsa-miR-3924	PAR-CLIP	21572407
MIRT509696	hsa-miR-6516-3p	PAR-CLIP	21572407
MIRT557823	hsa-miR-493-5p	PAR-CLIP	21572407
MIRT509700	hsa-miR-5580-3p	PAR-CLIP	21572407
MIRT548177	hsa-miR-181a-5p	PAR-CLIP	21572407
MIRT548176	hsa-miR-181b-5p	PAR-CLIP	21572407
MIRT548175	hsa-miR-181c-5p	PAR-CLIP	21572407
MIRT548174	hsa-miR-181d-5p	PAR-CLIP	21572407
MIRT548173	hsa-miR-4262	PAR-CLIP	21572407
MIRT509699	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT509698	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT509697	hsa-miR-3924	PAR-CLIP	21572407
MIRT509696	hsa-miR-6516-3p	PAR-CLIP	21572407
MIRT509700	hsa-miR-5580-3p	PAR-CLIP	23446348
MIRT509699	hsa-miR-5011-5p	PAR-CLIP	23446348
MIRT509698	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT509697	hsa-miR-3924	PAR-CLIP	23446348
MIRT509696	hsa-miR-6516-3p	PAR-CLIP	23446348
MIRT509700	hsa-miR-5580-3p	HITS-CLIP	21572407
MIRT557825	hsa-miR-410-3p	HITS-CLIP	21572407
MIRT509699	hsa-miR-5011-5p	HITS-CLIP	21572407
MIRT509698	hsa-miR-190a-3p	HITS-CLIP	21572407
MIRT509697	hsa-miR-3924	HITS-CLIP	21572407
MIRT509696	hsa-miR-6516-3p	HITS-CLIP	21572407
MIRT647666	hsa-miR-4686	HITS-CLIP	23824327
MIRT647665	hsa-miR-6729-3p	HITS-CLIP	23824327
MIRT647664	hsa-miR-6892-3p	HITS-CLIP	23824327
MIRT647663	hsa-miR-2276-5p	HITS-CLIP	23824327
MIRT647662	hsa-miR-3183	HITS-CLIP	23824327
MIRT647661	hsa-miR-4723-3p	HITS-CLIP	23824327
MIRT647660	hsa-miR-6769b-3p	HITS-CLIP	23824327
MIRT647659	hsa-miR-7110-3p	HITS-CLIP	23824327
MIRT647658	hsa-miR-6817-3p	HITS-CLIP	23824327
MIRT647657	hsa-miR-6728-3p	HITS-CLIP	23824327
MIRT647656	hsa-miR-20a-3p	HITS-CLIP	23824327
MIRT647655	hsa-miR-642a-5p	HITS-CLIP	23824327
MIRT647654	hsa-miR-6873-3p	HITS-CLIP	23824327
MIRT633744	hsa-miR-8485	HITS-CLIP	23824327
MIRT633743	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT633742	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT633741	hsa-miR-603	HITS-CLIP	23824327
MIRT633740	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT633739	hsa-miR-4643	HITS-CLIP	23824327
MIRT548177	hsa-miR-181a-5p	HITS-CLIP	23824327
MIRT548176	hsa-miR-181b-5p	HITS-CLIP	23824327
MIRT548175	hsa-miR-181c-5p	HITS-CLIP	23824327
MIRT548174	hsa-miR-181d-5p	HITS-CLIP	23824327
MIRT548173	hsa-miR-4262	HITS-CLIP	23824327
MIRT633738	hsa-miR-5195-5p	HITS-CLIP	23824327
MIRT633737	hsa-miR-3941	HITS-CLIP	23824327
MIRT633736	hsa-miR-466	HITS-CLIP	23824327
MIRT509696	hsa-miR-6516-3p	HITS-CLIP	23824327
MIRT509700	hsa-miR-5580-3p	PAR-CLIP	21572407
MIRT548177	hsa-miR-181a-5p	PAR-CLIP	21572407
MIRT548176	hsa-miR-181b-5p	PAR-CLIP	21572407
MIRT548175	hsa-miR-181c-5p	PAR-CLIP	21572407
MIRT548174	hsa-miR-181d-5p	PAR-CLIP	21572407
MIRT548173	hsa-miR-4262	PAR-CLIP	21572407
MIRT557825	hsa-miR-410-3p	PAR-CLIP	21572407
MIRT509699	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT557824	hsa-miR-3177-5p	PAR-CLIP	21572407
MIRT509698	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT509697	hsa-miR-3924	PAR-CLIP	21572407
MIRT509696	hsa-miR-6516-3p	PAR-CLIP	21572407
MIRT557823	hsa-miR-493-5p	PAR-CLIP	21572407
MIRT509700	hsa-miR-5580-3p	PAR-CLIP	21572407
MIRT548177	hsa-miR-181a-5p	PAR-CLIP	21572407
MIRT548176	hsa-miR-181b-5p	PAR-CLIP	21572407
MIRT548175	hsa-miR-181c-5p	PAR-CLIP	21572407
MIRT548174	hsa-miR-181d-5p	PAR-CLIP	21572407
MIRT548173	hsa-miR-4262	PAR-CLIP	21572407
MIRT509699	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT509698	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT509697	hsa-miR-3924	PAR-CLIP	21572407
MIRT509696	hsa-miR-6516-3p	PAR-CLIP	21572407
MIRT509700	hsa-miR-5580-3p	PAR-CLIP	23446348
MIRT509699	hsa-miR-5011-5p	PAR-CLIP	23446348
MIRT509698	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT509697	hsa-miR-3924	PAR-CLIP	23446348
MIRT509696	hsa-miR-6516-3p	PAR-CLIP	23446348
MIRT1002454	hsa-miR-24	CLIP-seq
MIRT1002455	hsa-miR-2467-5p	CLIP-seq
MIRT1002456	hsa-miR-3127-5p	CLIP-seq
MIRT1002457	hsa-miR-3155	CLIP-seq
MIRT1002458	hsa-miR-3155b	CLIP-seq
MIRT1002459	hsa-miR-33a	CLIP-seq
MIRT1002460	hsa-miR-33b	CLIP-seq
MIRT1002461	hsa-miR-361-5p	CLIP-seq
MIRT1002462	hsa-miR-3918	CLIP-seq
MIRT1002463	hsa-miR-4505	CLIP-seq
MIRT1002464	hsa-miR-4512	CLIP-seq
MIRT1002465	hsa-miR-4699-5p	CLIP-seq
MIRT1002466	hsa-miR-484	CLIP-seq
MIRT1002467	hsa-miR-569	CLIP-seq
MIRT1002468	hsa-miR-658	CLIP-seq
MIRT1002456	hsa-miR-3127-5p	CLIP-seq
MIRT1002459	hsa-miR-33a	CLIP-seq
MIRT1002460	hsa-miR-33b	CLIP-seq
MIRT1002462	hsa-miR-3918	CLIP-seq
MIRT1002464	hsa-miR-4512	CLIP-seq
MIRT1002465	hsa-miR-4699-5p	CLIP-seq
MIRT1002456	hsa-miR-3127-5p	CLIP-seq
MIRT1002459	hsa-miR-33a	CLIP-seq
MIRT1002460	hsa-miR-33b	CLIP-seq
MIRT1002462	hsa-miR-3918	CLIP-seq
MIRT1002464	hsa-miR-4512	CLIP-seq
MIRT1002465	hsa-miR-4699-5p	CLIP-seq
MIRT1997130	hsa-miR-1224-3p	CLIP-seq
MIRT1002456	hsa-miR-3127-5p	CLIP-seq
MIRT1002459	hsa-miR-33a	CLIP-seq
MIRT1002460	hsa-miR-33b	CLIP-seq
MIRT1997131	hsa-miR-3714	CLIP-seq
MIRT1002462	hsa-miR-3918	CLIP-seq
MIRT1997132	hsa-miR-4434	CLIP-seq
MIRT1002464	hsa-miR-4512	CLIP-seq
MIRT1997133	hsa-miR-4516	CLIP-seq
MIRT1002465	hsa-miR-4699-5p	CLIP-seq
MIRT1997134	hsa-miR-4783-5p	CLIP-seq
MIRT1997135	hsa-miR-940	CLIP-seq
MIRT2230948	hsa-miR-1323	CLIP-seq
MIRT2230949	hsa-miR-136	CLIP-seq
MIRT1002456	hsa-miR-3127-5p	CLIP-seq
MIRT1002459	hsa-miR-33a	CLIP-seq
MIRT1002460	hsa-miR-33b	CLIP-seq
MIRT1002462	hsa-miR-3918	CLIP-seq
MIRT1002464	hsa-miR-4512	CLIP-seq
MIRT1002465	hsa-miR-4699-5p	CLIP-seq
MIRT2230950	hsa-miR-548o	CLIP-seq
MIRT2230951	hsa-miR-885-5p	CLIP-seq
MIRT2388139	hsa-miR-125a-5p	CLIP-seq
MIRT2388140	hsa-miR-125b	CLIP-seq
MIRT2388141	hsa-miR-1293	CLIP-seq
MIRT2388142	hsa-miR-141	CLIP-seq
MIRT2388143	hsa-miR-200a	CLIP-seq
MIRT1002456	hsa-miR-3127-5p	CLIP-seq
MIRT1002459	hsa-miR-33a	CLIP-seq
MIRT1002460	hsa-miR-33b	CLIP-seq
MIRT1002461	hsa-miR-361-5p	CLIP-seq
MIRT1002462	hsa-miR-3918	CLIP-seq
MIRT2388144	hsa-miR-4319	CLIP-seq
MIRT2388145	hsa-miR-4483	CLIP-seq
MIRT1002464	hsa-miR-4512	CLIP-seq
MIRT1002465	hsa-miR-4699-5p	CLIP-seq
MIRT2388146	hsa-miR-4732-3p	CLIP-seq
MIRT2388147	hsa-miR-670	CLIP-seq
MIRT2388148	hsa-miR-876-3p	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
GLI2	Unknown	19360354

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	ISA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0003677	Function	DNA binding	IDA	7957066
GO:0003677	Function	DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0003700	Function	DNA-binding transcription factor activity	ISS
GO:0005634	Component	Nucleus	IC	7957066
GO:0005634	Component	Nucleus	IDA	34633540
GO:0005634	Component	Nucleus	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0007495	Process	Visceral mesoderm-endoderm interaction involved in midgut development	IEA
GO:0007495	Process	Visceral mesoderm-endoderm interaction involved in midgut development	ISS
GO:0007507	Process	Heart development	IMP	21457232
GO:0008301	Function	DNA binding, bending	NAS	7957066
GO:0009653	Process	Anatomical structure morphogenesis	IBA
GO:0030111	Process	Regulation of Wnt signaling pathway	IEA
GO:0030111	Process	Regulation of Wnt signaling pathway	ISS
GO:0030154	Process	Cell differentiation	IBA
GO:0030166	Process	Proteoglycan biosynthetic process	IEA
GO:0030166	Process	Proteoglycan biosynthetic process	ISS
GO:0043565	Function	Sequence-specific DNA binding	IDA	7957066
GO:0043565	Function	Sequence-specific DNA binding	IEA
GO:0061146	Process	Peyer's patch morphogenesis	IEA

Other IDs

• MIM: 603252
• HGNC: 3817
• e!Ensembl: ENSG00000176678

Protein

• UniProt ID: Q12952
• Protein name: Forkhead box protein L1 (Forkhead-related protein FKHL11) (Forkhead-related transcription factor 7) (FREAC-7)
• Protein function: Transcription factor required for proper proliferation and differentiation in the gastrointestinal epithelium. Target gene of the hedgehog (Hh) signaling pathway via GLI2 and GLI3 transcription factors (By similarity).
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00250	Forkhead	48 → 134	Forkhead domain	Domain

• Sequence:

  MSHLFDPRLPALAASPMLYLYGPERPGLPLAFAPAAALAASGRAETPQKPPYSYIALIAM
  AIQDAPEQRVTLNGIYQFIMDRFPFYHDNRQGWQNSIRHNLSLNDCFVKVPREKGRPGKG
  SYWTLDPRCLDMFENGNYRRRKRKPKPGPGAPEAKRPRAETHQRSAEAQPEAGSGAGGSG
  PAISRLQAAPAGPSPLLDGPSPPAPLHWPGTASPNEDAGDAAQGAAAVAVGQAARTGDGP
  GSPLRPASRSSPKSSDKSKSFSIDSILAGKQGQKPPSGDELLGGAKPGPGGRLGASLLAA
  SSSLRPPFNASLMLDPHVQGGFYQLGIPFLSYFPLQVPDTVLHFQ

• Sequence length: 345

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
COLORECTAL ADENOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGENITAL HEART DISEASE	—	ClinGen, Disgenet ClinGen, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ATHEROSCLEROSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DENTAL CARIES	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIVERTICULAR DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEMORRHOID	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE SYSTEM ATROPHY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL INFARCTION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL ISCHEMIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Otosclerosis 11	Conflicting classifications of pathogenicity	ClinVar ClinVar, Disgenet, GenCC, HPO ClinVar, Disgenet, GenCC, HPO ClinVar, Disgenet, GenCC, HPO	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
RETINOPATHY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC JUVENILE IDIOPATHIC ARTHRITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TETRALOGY OF FALLOT	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	23801748		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	27938507		★☆☆☆☆ Found in Text Mining only
Carcinoma Adenoid Cystic	Adenoid cystic carcinoma	Pubtator	21692051	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	27458175	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	24427331	Inhibit	★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	Pubtator	32196466	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	25990418		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	37305399	Associate	★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	30971290		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	32041280	Associate	★☆☆☆☆ Found in Text Mining only
Gallbladder Carcinoma	Gallbladder cancer	BEFREE	25010679		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	31289550		★☆☆☆☆ Found in Text Mining only
Hypoplastic Left Heart Syndrome	Hypoplastic Left Heart Syndrome	BEFREE	19500772		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	32946266	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	24427331	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	24427331, 26960689	Associate	★☆☆☆☆ Found in Text Mining only
Lymphedema distichiasis syndrome	Lymphedema	Pubtator	22407726	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	27938507		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gallbladder	Gallbladder cancer	BEFREE	25010679		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	23801748, 26820810		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	26062977		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	27938507		★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	30971290		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	21536545, 23131872, 23801748, 25010679, 25395235, 26062977, 26820810, 28867346		★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	25132170	Associate	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	26062977		★☆☆☆☆ Found in Text Mining only
Otosclerosis	Otosclerosis	Pubtator	34633540	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	23801748		★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	23801748		★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	Pubtator	24427331	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	31682594	Associate	★☆☆☆☆ Found in Text Mining only
Respiratory Tract Diseases	Respiratory system infectious disease	Pubtator	37925496	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	Pubtator	21536545	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	26960689, 30106137	Associate	★☆☆☆☆ Found in Text Mining only