Gene Gene information from NCBI Gene database.
Entrez ID 2299
Gene name Forkhead box I1
Gene symbol FOXI1
Synonyms (NCBI Gene)
FKH10FKHL10FREAC-6FREAC6HFH-3HFH3
Chromosome 5
Chromosome location 5q35.1
Summary This gene belongs to the forkhead family of transcription factors, which is characterized by a distinct forkhead domain. This gene may play an important role in the development of the cochlea and vestibulum, as well as in embryogenesis. The encoded protei
SNPs SNP information provided by dbSNP.
3
SNP ID Visualize variation Clinical significance Consequence
rs121909340 G>A Pathogenic, uncertain-significance Intron variant, missense variant, downstream transcript variant, coding sequence variant, genic downstream transcript variant
rs121909341 G>A,C Pathogenic Intron variant, missense variant, downstream transcript variant, coding sequence variant, genic downstream transcript variant
rs147596900 C>T Conflicting-interpretations-of-pathogenicity, uncertain-significance Synonymous variant, downstream transcript variant, genic downstream transcript variant, coding sequence variant, intron variant
miRNA miRNA information provided by mirtarbase database.
23
miRTarBase ID miRNA Experiments Reference
MIRT017392 hsa-miR-335-5p Microarray 18185580
MIRT1001668 hsa-miR-1184 CLIP-seq
MIRT1001669 hsa-miR-1205 CLIP-seq
MIRT1001670 hsa-miR-1293 CLIP-seq
MIRT1001671 hsa-miR-3158-5p CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
30
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin ISA
GO:0000976 Function Transcription cis-regulatory region binding IEA
GO:0000976 Function Transcription cis-regulatory region binding ISS
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IDA 19214237
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
601093 3815 ENSG00000168269
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q12951
Protein name Forkhead box protein I1 (Forkhead-related protein FKHL10) (Forkhead-related transcription factor 6) (FREAC-6) (Hepatocyte nuclear factor 3 forkhead homolog 3) (HFH-3) (HNF-3/fork-head homolog 3)
Protein function Transcriptional activator required for the development of normal hearing, sense of balance and kidney function. Required for the expression of SLC26A4/PDS, JAG1 and COCH in a subset of epithelial cells and the development of the endolymphatic sy
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00250 Forkhead 122 208 Forkhead domain Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in kidney.
Sequence
MSSFDLPAPSPPRCSPQFPSIGQEPPEMNLYYENFFHPQGVPSPQRPSFEGGGEYGATPN
PYLWFNGPTMTPPPYLPGPNASPFLPQAYGVQRPLLPSVSGLGGSDLGWLPIPSQEELMK
LVRPPYSYSALIAMAIHGAPDKRLTLSQIYQYVADNFPFYNKSKAGWQNSIRHNLSLNDC
FKKVPRDEDDPGKGNYWTLDPNCEKMFD
NGNFRRKRKRKSDVSSSTASLALEKTESSLPV
DSPKTTEPQDILDGASPGGTTSSPEKRPSPPPSGAPCLNSFLSSMTAYVSGGSPTSHPLV
TPGLSPEPSDKTGQNSLTFNSFSPLTNLSNHSGGGDWANPMPTNMLSYGGSVLSQFSPHF
YNSVNTSGVLYPREGTEV
Sequence length 378
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
16
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession Evidence Score
Hearing impairment Likely pathogenic rs777573595 RCV001375208
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
AUTOSOMAL RECESSIVE DISTAL RENAL TUBULAR ACIDOSIS GWAS catalog, Orphanet
GWAS catalog, Orphanet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Autosomal recessive nonsyndromic hearing loss 4 Uncertain significance; Likely benign; Conflicting classifications of pathogenicity; Benign ClinVar
ClinVar, GenCC
★★★☆☆
Reported in Unknown/Other Associations (≥2 sources)
BREAST CARCINOMA GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Cervical cancer Benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Anemia, Hemolytic, Congenital Anemia BEFREE 31600869
★☆☆☆☆
Found in Text Mining only
Autosomal recessive distal renal tubular acidosis Renal Tubular Acidosis Orphanet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Carcinoma Large Cell Large cell carcinoma Pubtator 38168015 Stimulate
★☆☆☆☆
Found in Text Mining only
Carcinoma Renal Cell Renal cell carcinoma Pubtator 32299640, 36681680 Associate
★☆☆☆☆
Found in Text Mining only
Chromophobe Renal Cell Carcinoma Chromophobe Carcinoma BEFREE 31177114
★☆☆☆☆
Found in Text Mining only
Compensated hypothyroidism Compensated hypothyroidism HPO_DG
★☆☆☆☆
Found in Text Mining only
Congenital bilateral aplasia of vas deferens Congenital bilateral absence of vas deferens Pubtator 20972246 Associate
★☆☆☆☆
Found in Text Mining only
Congenital sensorineural hearing loss Congenital Sensorineural Hearing Loss HPO_DG
★☆☆☆☆
Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma Renal Carcinoma BEFREE 28793269
★☆☆☆☆
Found in Text Mining only
Cystic Fibrosis Cystic Fibrosis BEFREE 30069044, 30069046
★☆☆☆☆
Found in Text Mining only