Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	22980
Gene name	TCF25 ribosome quality control complex subunit
Gene symbol	TCF25
Synonyms (NCBI Gene)	FKSG26Hulp1NULP1PRO2620hKIAA1049
Chromosome	16
Chromosome location	16q24.3
Summary	TCF25 is a member of the basic helix-loop-helix (bHLH) family of transcription factors that are important in embryonic development (Steen and Lindholm, 2008 [PubMed 18068114]).[supplied by OMIM, Sep 2008]

Show/Hide all (45)

miRTarBase ID	miRNA	Experiments	Reference
MIRT050402	hsa-miR-23a-3p	CLASH	23622248
MIRT046271	hsa-miR-23b-3p	CLASH	23622248
MIRT037265	hsa-miR-877-5p	CLASH	23622248
MIRT1416170	hsa-miR-3162-3p	CLIP-seq
MIRT1416171	hsa-miR-4269	CLIP-seq
MIRT1416172	hsa-miR-4514	CLIP-seq
MIRT1416173	hsa-miR-4692	CLIP-seq
MIRT1416174	hsa-miR-4742-5p	CLIP-seq
MIRT1416175	hsa-miR-512-5p	CLIP-seq
MIRT1416176	hsa-miR-603	CLIP-seq
MIRT2124822	hsa-miR-193a-3p	CLIP-seq
MIRT2124823	hsa-miR-193b	CLIP-seq
MIRT1416170	hsa-miR-3162-3p	CLIP-seq
MIRT2124824	hsa-miR-3619-3p	CLIP-seq
MIRT2124825	hsa-miR-3919	CLIP-seq
MIRT1416171	hsa-miR-4269	CLIP-seq
MIRT1416172	hsa-miR-4514	CLIP-seq
MIRT1416173	hsa-miR-4692	CLIP-seq
MIRT2124826	hsa-miR-4729	CLIP-seq
MIRT1416174	hsa-miR-4742-5p	CLIP-seq
MIRT2124827	hsa-miR-4776-5p	CLIP-seq
MIRT2124828	hsa-miR-4800-5p	CLIP-seq
MIRT2124829	hsa-miR-487a	CLIP-seq
MIRT1416175	hsa-miR-512-5p	CLIP-seq
MIRT2124830	hsa-miR-539	CLIP-seq
MIRT1416176	hsa-miR-603	CLIP-seq
MIRT2124822	hsa-miR-193a-3p	CLIP-seq
MIRT2124823	hsa-miR-193b	CLIP-seq
MIRT1416170	hsa-miR-3162-3p	CLIP-seq
MIRT2124825	hsa-miR-3919	CLIP-seq
MIRT1416171	hsa-miR-4269	CLIP-seq
MIRT1416172	hsa-miR-4514	CLIP-seq
MIRT1416173	hsa-miR-4692	CLIP-seq
MIRT1416174	hsa-miR-4742-5p	CLIP-seq
MIRT2124829	hsa-miR-487a	CLIP-seq
MIRT1416175	hsa-miR-512-5p	CLIP-seq
MIRT2124830	hsa-miR-539	CLIP-seq
MIRT1416176	hsa-miR-603	CLIP-seq
MIRT1416170	hsa-miR-3162-3p	CLIP-seq
MIRT1416171	hsa-miR-4269	CLIP-seq
MIRT1416172	hsa-miR-4514	CLIP-seq
MIRT1416173	hsa-miR-4692	CLIP-seq
MIRT1416174	hsa-miR-4742-5p	CLIP-seq
MIRT1416175	hsa-miR-512-5p	CLIP-seq
MIRT1416176	hsa-miR-603	CLIP-seq

Show/Hide all (8)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	16189514, 19060904, 21516116, 24947832, 25416956, 28514442, 31046837, 31515488, 32296183, 32814053, 33961781, 35271311
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IEA
GO:0061945	Process	Regulation of protein K48-linked ubiquitination	IDA	30244831
GO:0072344	Process	Rescue of stalled ribosome	IDA	30244831
GO:1990112	Component	RQC complex	IBA
GO:1990112	Component	RQC complex	IDA	30244831

MIM	HGNC	e!Ensembl
612326	29181	ENSG00000141002

Q9BQ70

Protein name

Ribosome quality control complex subunit TCF25 (Nuclear localized protein 1) (Transcription factor 25) (TCF-25)

Protein function

Component of the ribosome quality control complex (RQC), a ribosome-associated complex that mediates ubiquitination and extraction of incompletely synthesized nascent chains for proteasomal degradation (PubMed:30244831). In the RQC complex, requ

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF04910	Tcf25	248 → 588	Transcriptional repressor TCF25	Family

Tissue specificity

TISSUE SPECIFICITY: In the embryo, widely expressed with highest levels in brain (PubMed:16574069). In the adult, highest expression is found in the heart (PubMed:16574069, PubMed:32805187). Repressed in cardiac tissue of patients with heart failure (at p

Sequence

MSRRALRRLRGEQRGQEPLGPGALHFDLRDDDDAEEEGPKRELGVRRPGGAGKEGVRVNN
RFELINIDDLEDDPVVNGERSGCALTDAVAPGNKGRGQRGNTESKTDGDDTETVPSEQSH
ASGKLRKKKKKQKNKKSSTGEASENGLEDIDRILERIEDSTGLNRPGPAPLSSRKHVLYV
EHRHLNPDTELKRYFGARAILGEQRPRQRQRVYPKCTWLTTPKSTWPRYSKPGLSMRLLE
SKKGLSFFAFEHSEEYQQAQHKFLVAVESMEPNNIVVLLQTSPYHVDSLLQLSDACRFQE
DQEMARDLVERALYSMECAFHPLFSLTSGACRLDYRRPENRSFYLALYKQMSFLEKRGCP
RTALEYCKLILSLEPDEDPLCMLLLIDHLALRARNYEYLIRLFQEWEAHRNLSQLPNFAF
SVPLAYFLLSQQTDLPECEQSSARQKASLLIQQALTMFPGVLLPLLESCSVRPDASVSSH
RFFGPNAEISQPPALSQLVNLYLGRSHFLWKEPATMSWLEENVHEVLQAVDAGDPAVEAC
ENRRKVLYQRAPRNIHRHVILSEIKEAVAALPPDVTTQSVMGFDPLPPSDTIYSYVRPER
LSPISHGNTIALFFRSLLPNYTMEGERPEEGVAGGLNRNQGLNRLMLAVRDMMANFHLND
LEAPHEDDAEGEGEWD

Sequence length

676

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (5)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BASAL CELL CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant lymphoma, large B-cell, diffuse	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (3)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Arrhythmogenic Right Ventricular Dysplasia	Arrhythmogenic right ventricular cardiomyopathy	Pubtator	29221435	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	GWASDB_DG	21211798		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	18045611		★★★★★ ★☆☆☆☆ Found in Text Mining only

TCF25 (TCF25 ribosome quality control complex subunit)