TPX2 (TPX2 microtubule nucleation factor)

Gene

• Entrez ID: 22974
• Gene name: TPX2 microtubule nucleation factor
• Gene symbol: TPX2
• Synonyms (NCBI Gene): C20orf1, C20orf2, DIL-2, DIL2, FLS353, GD:C20orf1, HCA519, HCTP4, REPP86, p100
• Chromosome: 20
• Chromosome location: 20q11.21

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT041448	hsa-miR-193b-3p	CLASH	23622248
MIRT733798	hsa-miR-338-3p	Microarray, qRT-PCR	33789319
MIRT736547	hsa-miR-548a-3p	Luciferase reporter assay, Western blotting, qRT-PCR	32857606
MIRT737338	hsa-miR-216b-3p	Luciferase reporter assay, Western blotting, Immunohistochemistry (IHC), qRT-PCR, Flow cytometry	32169806
MIRT755887	hsa-miR-29c-3p	Luciferase reporter assay, Western blotting, qRT-PCR	35340555
MIRT1450484	hsa-miR-1266	CLIP-seq
MIRT1450485	hsa-miR-1289	CLIP-seq
MIRT1450486	hsa-miR-1304	CLIP-seq
MIRT1450487	hsa-miR-1323	CLIP-seq
MIRT1450488	hsa-miR-216a	CLIP-seq
MIRT1450489	hsa-miR-216b	CLIP-seq
MIRT1450490	hsa-miR-219-5p	CLIP-seq
MIRT1450491	hsa-miR-2278	CLIP-seq
MIRT1450492	hsa-miR-2467-3p	CLIP-seq
MIRT1450493	hsa-miR-3065-5p	CLIP-seq
MIRT1450494	hsa-miR-3150a-3p	CLIP-seq
MIRT1450495	hsa-miR-3159	CLIP-seq
MIRT1450496	hsa-miR-3160-5p	CLIP-seq
MIRT1450497	hsa-miR-3175	CLIP-seq
MIRT1450498	hsa-miR-3198	CLIP-seq
MIRT1450499	hsa-miR-3622a-5p	CLIP-seq
MIRT1450500	hsa-miR-3664-3p	CLIP-seq
MIRT1450501	hsa-miR-3667-5p	CLIP-seq
MIRT1450502	hsa-miR-3675-3p	CLIP-seq
MIRT1450503	hsa-miR-3678-3p	CLIP-seq
MIRT1450504	hsa-miR-3713	CLIP-seq
MIRT1450505	hsa-miR-3920	CLIP-seq
MIRT1450506	hsa-miR-4269	CLIP-seq
MIRT1450507	hsa-miR-4282	CLIP-seq
MIRT1450508	hsa-miR-4294	CLIP-seq
MIRT1450509	hsa-miR-4309	CLIP-seq
MIRT1450510	hsa-miR-4317	CLIP-seq
MIRT1450511	hsa-miR-4326	CLIP-seq
MIRT1450512	hsa-miR-4445	CLIP-seq
MIRT1450513	hsa-miR-4464	CLIP-seq
MIRT1450514	hsa-miR-4514	CLIP-seq
MIRT1450515	hsa-miR-4518	CLIP-seq
MIRT1450516	hsa-miR-4660	CLIP-seq
MIRT1450517	hsa-miR-4692	CLIP-seq
MIRT1450518	hsa-miR-4693-3p	CLIP-seq
MIRT1450519	hsa-miR-4699-3p	CLIP-seq
MIRT1450520	hsa-miR-4729	CLIP-seq
MIRT1450521	hsa-miR-4742-5p	CLIP-seq
MIRT1450522	hsa-miR-4748	CLIP-seq
MIRT1450523	hsa-miR-4782-3p	CLIP-seq
MIRT1450524	hsa-miR-4796-3p	CLIP-seq
MIRT1450525	hsa-miR-491-5p	CLIP-seq
MIRT1450526	hsa-miR-508-3p	CLIP-seq
MIRT1450527	hsa-miR-513c	CLIP-seq
MIRT1450528	hsa-miR-514b-5p	CLIP-seq
MIRT1450529	hsa-miR-548e	CLIP-seq
MIRT1450530	hsa-miR-548f	CLIP-seq
MIRT1450531	hsa-miR-548o	CLIP-seq
MIRT1450532	hsa-miR-554	CLIP-seq
MIRT1450533	hsa-miR-564	CLIP-seq
MIRT1450534	hsa-miR-570	CLIP-seq
MIRT1450535	hsa-miR-642b	CLIP-seq
MIRT1450536	hsa-miR-651	CLIP-seq
MIRT1450537	hsa-miR-759	CLIP-seq
MIRT1450538	hsa-miR-939	CLIP-seq
MIRT2134659	hsa-miR-1253	CLIP-seq
MIRT1450485	hsa-miR-1289	CLIP-seq
MIRT1450486	hsa-miR-1304	CLIP-seq
MIRT2134660	hsa-miR-181a	CLIP-seq
MIRT2134661	hsa-miR-181b	CLIP-seq
MIRT2134662	hsa-miR-181c	CLIP-seq
MIRT2134663	hsa-miR-181d	CLIP-seq
MIRT1450491	hsa-miR-2278	CLIP-seq
MIRT1450492	hsa-miR-2467-3p	CLIP-seq
MIRT2134664	hsa-miR-299-5p	CLIP-seq
MIRT2134665	hsa-miR-3163	CLIP-seq
MIRT1450498	hsa-miR-3198	CLIP-seq
MIRT2134666	hsa-miR-3614-3p	CLIP-seq
MIRT1450501	hsa-miR-3667-5p	CLIP-seq
MIRT1450503	hsa-miR-3678-3p	CLIP-seq
MIRT1450504	hsa-miR-3713	CLIP-seq
MIRT2134667	hsa-miR-3919	CLIP-seq
MIRT2134668	hsa-miR-4262	CLIP-seq
MIRT1450508	hsa-miR-4294	CLIP-seq
MIRT1450509	hsa-miR-4309	CLIP-seq
MIRT1450510	hsa-miR-4317	CLIP-seq
MIRT2134669	hsa-miR-433	CLIP-seq
MIRT2134670	hsa-miR-4424	CLIP-seq
MIRT1450513	hsa-miR-4464	CLIP-seq
MIRT2134671	hsa-miR-4528	CLIP-seq
MIRT1450522	hsa-miR-4748	CLIP-seq
MIRT2134672	hsa-miR-4802-3p	CLIP-seq
MIRT1450532	hsa-miR-554	CLIP-seq
MIRT2134673	hsa-miR-606	CLIP-seq
MIRT1450535	hsa-miR-642b	CLIP-seq
MIRT1450537	hsa-miR-759	CLIP-seq
MIRT2134660	hsa-miR-181a	CLIP-seq
MIRT2134661	hsa-miR-181b	CLIP-seq
MIRT2134662	hsa-miR-181c	CLIP-seq
MIRT2134663	hsa-miR-181d	CLIP-seq
MIRT2355963	hsa-miR-1972	CLIP-seq
MIRT2134664	hsa-miR-299-5p	CLIP-seq
MIRT2134665	hsa-miR-3163	CLIP-seq
MIRT1450501	hsa-miR-3667-5p	CLIP-seq
MIRT1450504	hsa-miR-3713	CLIP-seq
MIRT2355964	hsa-miR-3908	CLIP-seq
MIRT2355965	hsa-miR-3936	CLIP-seq
MIRT2355966	hsa-miR-3942-5p	CLIP-seq
MIRT2134668	hsa-miR-4262	CLIP-seq
MIRT1450508	hsa-miR-4294	CLIP-seq
MIRT1450510	hsa-miR-4317	CLIP-seq
MIRT2355967	hsa-miR-4645-5p	CLIP-seq
MIRT1450516	hsa-miR-4660	CLIP-seq
MIRT2355968	hsa-miR-4673	CLIP-seq
MIRT2355969	hsa-miR-4688	CLIP-seq
MIRT1450518	hsa-miR-4693-3p	CLIP-seq
MIRT2355970	hsa-miR-4703-5p	CLIP-seq
MIRT2355971	hsa-miR-4766-3p	CLIP-seq
MIRT2355972	hsa-miR-548t	CLIP-seq
MIRT1450532	hsa-miR-554	CLIP-seq
MIRT1450535	hsa-miR-642b	CLIP-seq
MIRT1450537	hsa-miR-759	CLIP-seq
MIRT2134664	hsa-miR-299-5p	CLIP-seq
MIRT2134665	hsa-miR-3163	CLIP-seq
MIRT1450501	hsa-miR-3667-5p	CLIP-seq
MIRT1450532	hsa-miR-554	CLIP-seq
MIRT1450535	hsa-miR-642b	CLIP-seq
MIRT1450537	hsa-miR-759	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000278	Process	Mitotic cell cycle	TAS	9207457
GO:0000922	Component	Spindle pole	IDA	14718566
GO:0000922	Component	Spindle pole	IEA
GO:0005515	Function	Protein binding	IPI	14580337, 17474147, 19357306, 20360068, 21242313, 22110403, 25416956, 25986610, 27837025, 28514442, 32296183, 32814053, 33961781
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	TAS	9207457
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IEA
GO:0005819	Component	Spindle	IDA	37728657
GO:0005819	Component	Spindle	IEA
GO:0005819	Component	Spindle	ISS	18663142
GO:0005819	Component	Spindle	TAS	9207457
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IEA
GO:0005874	Component	Microtubule	IEA
GO:0006915	Process	Apoptotic process	IEA
GO:0007020	Process	Microtubule nucleation	IDA	26414402
GO:0007026	Process	Negative regulation of microtubule depolymerization	IDA	26414402
GO:0015630	Component	Microtubule cytoskeleton	IDA
GO:0019901	Function	Protein kinase binding	IEA
GO:0019901	Function	Protein kinase binding	IPI	14580337, 18662907, 19801554
GO:0032147	Process	Activation of protein kinase activity	IDA	14580337
GO:0043203	Component	Axon hillock	IEA
GO:0043539	Function	Protein serine/threonine kinase activator activity	IDA	19801554
GO:0045171	Component	Intercellular bridge	IDA
GO:0051301	Process	Cell division	IEA
GO:0060090	Function	Molecular adaptor activity	IDA	37728657
GO:0060236	Process	Regulation of mitotic spindle organization	IEA
GO:0060236	Process	Regulation of mitotic spindle organization	ISS	18663142
GO:0061676	Function	Importin-alpha family protein binding	IDA	26165940
GO:0061676	Function	Importin-alpha family protein binding	IEA
GO:0072686	Component	Mitotic spindle	IDA
GO:0090307	Process	Mitotic spindle assembly	IDA	19001501
GO:0090307	Process	Mitotic spindle assembly	IDA	26165940, 37728657
GO:0090307	Process	Mitotic spindle assembly	IEA

Other IDs

• MIM: 605917
• HGNC: 1249
• e!Ensembl: ENSG00000088325

Protein

• UniProt ID: Q9ULW0
• Protein name: Targeting protein for Xklp2 (Differentially expressed in cancerous and non-cancerous lung cells 2) (DIL-2) (Hepatocellular carcinoma-associated antigen 519) (Hepatocellular carcinoma-associated antigen 90) (Protein fls353) (Restricted expression prolifera
• Protein function: Spindle assembly factor required for normal assembly of mitotic spindles. Required for normal assembly of microtubules during apoptosis. Required for chromatin and/or kinetochore dependent microtubule nucleation. Mediates AURKA localization to s
• PDB: 1OL5, 3E5A, 3HA6, 4C3P, 5LXM, 6BJC, 6VPG, 6VPH, 6VPI, 6VPJ, 6VPL, 6VPM, 6XKA
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF09041	Aurora-A_bind	1 → 68	Aurora-A binding	Disordered
  PF12214	TPX2_importin	361 → 489	Cell cycle regulated microtubule associated protein	Family
  PF06886	TPX2	540 → 592	Targeting protein for Xklp2 (TPX2) domain	Domain
  PF06886	TPX2	660 → 740	Targeting protein for Xklp2 (TPX2) domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed in lung carcinoma cell lines but not in normal lung tissues.
• Sequence:

  MSQVKSSYSYDAPSDFINFSSLDDEGDTQNIDSWFEEKANLENKLLGKNGTGGLFQGKTP
  LRKANLQQAIVTPLKPVDNTYYKEAEKENLVEQSIPSNACSSLEVEAAISRKTPAQPQRR
  SLRLSAQKDLEQKEKHHVKMKAKRCATPVIIDEILPSKKMKVSNNKKKPEEEGSAHQDTA
  EKNASSPEKAKGRHTVPCMPPAKQKFLKSTEEQELEKSMKMQQEVVEMRKKNEEFKKLAL
  AGIGQPVKKSVSQVTKSVDFHFRTDERIKQHPKNQEEYKEVNFTSELRKHPSSPARVTKG
  CTIVKPFNLSQGKKRTFDETVSTYVPLAQQVEDFHKRTPNRYHLRSKKDDINLLPSKSSV
  TKICRDPQTPVLQTKHRARAVTCKSTAELEAEELEKLQQYKFKARELDPRILEGGPILPK
  KPPVKPPTEPIGFDLEIEKRIQERESKKKTEDEHFEFHSRPCPTKILEDVVGVPEKKVLP
  ITVPKSPAFALKNRIRMPTKEDEEEDEPVVIKAQPVPHYGVPFKPQIPEARTVEICPFSF
  DSRDKERQLQKEKKIKELQKGEVPKFKALPLPHFDTINLPEKKVKNVTQIEPFCLETDRR
  GALKAQTWKHQLEEELRQQKEAACFKARPNTVISQEPFVPKKEKKSVAEGLSGSLVQEPF
  QLATEKRAKERQELEKRMAEVEAQKAQQLEEARLQEEEQKKEELARLRRELVHKANPIRK
  YQGLEIKSSDQPLTVPVSPKFSTRFHC

• Sequence length: 747

Pathways

Reactome:

Regulation of TP53 Activity through Phosphorylation
AURKA Activation by TPX2

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
CARCINOMA, HEPATOCELLULAR	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GILLES DE LA TOURETTE SYNDROME	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYELOPROLIFERATIVE DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	28277612, 28869599, 30588191		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of pancreas	Pancreatic adenocarcinoma	BEFREE	19861455		★☆☆☆☆ Found in Text Mining only
Adenoma of large intestine	Colorectal adenoma	BEFREE	22207630		★☆☆☆☆ Found in Text Mining only
Adult Hepatocellular Carcinoma	Liver carcinoma	BEFREE	30412141		★☆☆☆☆ Found in Text Mining only
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	BEFREE	8289813		★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	30415249		★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	30415249		★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	20599806		★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	29981961		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	30927274		★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone Disease	BEFREE	19770515		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	25830658, 28190248, 31799669, 9681829		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	23468873, 25830658, 29138345, 31285741, 31799669, 33499770, 33622270, 34384030, 36930083, 38643462	Associate	★☆☆☆☆ Found in Text Mining only
Cancer of Digestive System	Gastric Cancer	BEFREE	29551902		★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	25632068, 33029085	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	22207630		★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	12097419	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	32722976, 33102593, 34257537, 36120772, 36204642, 36304254, 36707511	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	23873098, 30927274		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	10512675, 16489064, 29159900		★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	24625450	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	15983384, 29483831, 37142730	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	28260099, 32309427, 32626756, 33154194, 34606125, 35896362	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	40362354	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	15983384	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	29904936		★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	22307108, 24718984, 30633364		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	22307108, 24718984, 30633364		★☆☆☆☆ Found in Text Mining only
Childhood Hepatocellular Carcinoma	Liver carcinoma	BEFREE	30412141		★☆☆☆☆ Found in Text Mining only
Chromosomal Instability	Chromosomal instability	Pubtator	33622270	Associate	★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	27955827		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	24341487		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	37770979	Associate	★☆☆☆☆ Found in Text Mining only
Color blindness	Color Blindness	BEFREE	10447644		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	10601642, 12209988, 25632068		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	UNIPROT_DG			★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	10601642	Stimulate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	25632068, 34577783, 37770979	Associate	★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	28108243		★☆☆☆☆ Found in Text Mining only
Dermatitis Contact	Contact dermatitis	Pubtator	33318199	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	28392940		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	28392940		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	30116745		★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	20889926, 24223200, 28368397		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	29888640		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	32705231, 33859719, 35356748, 36304254, 39596419	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	23725757, 25239289		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	25239289		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	26279431, 32443386	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	37083097	Associate	★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Sarcoma	Gastrointestinal stromal tumor	BEFREE	31553483		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	BEFREE	26952515		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	Pubtator	31553483	Associate	★☆☆☆☆ Found in Text Mining only
Glaucoma, Primary Open Angle	Glaucoma	BEFREE	30138396		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	25275596		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	25275596		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	25275596	Associate	★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	33160365	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	33102593, 36204642	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	25830658	Associate	★☆☆☆☆ Found in Text Mining only
leiomyosarcoma	Leiomyosarcoma	BEFREE	31301306		★☆☆☆☆ Found in Text Mining only
Leukemia, T-Cell	T-cell leukemia	BEFREE	8289813		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	12097419, 20388846, 28638452, 29606879, 30412141, 31593490		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	CTD_human_DG	28284560		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	LHGDN	16489064		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	32831194	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic Metastasis	BEFREE	23725757		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	23873098, 24488334, 28069036	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	10713675		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	21879811		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin, Familial	Lymphoma	BEFREE	21879811		★☆☆☆☆ Found in Text Mining only
Lymphoma, T-Cell, Cutaneous	Lymphoma	BEFREE	10713675		★☆☆☆☆ Found in Text Mining only
Malignant lymphoma, lymphocytic, intermediate differentiation, diffuse	Malignant lymphoma, lymphocytic, intermediate differentiation	BEFREE	20419314		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	25368990, 25830658, 28190248, 31799669, 9681829		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	29888640		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	25239289		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	30412141, 30548299		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	16489064, 29159900		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	29904936		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	19861455, 25914189, 28223795		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	22761906, 23333597, 28761362		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	27314162		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	30927274		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	16489064, 19801554, 19861455, 22307108, 24488334, 24556998, 24718984, 25914189, 26112410, 28277612, 28638452, 29551902, 29620263, 29888640		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	22307108, 24718984, 30633364		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	17909068, 24341487		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	28190248, 28993511		★☆☆☆☆ Found in Text Mining only
Mantle cell lymphoma	Mantle Cell Lymphoma	BEFREE	20419314		★☆☆☆☆ Found in Text Mining only
Medullary carcinoma of thyroid	Megalencephaly, Polymicrogyria, Polydactyly, Hydrocephalus Syndrome	BEFREE	24488334		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	30257313		★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	Pubtator	21157382	Associate	★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	18384222	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	10713675, 23211527, 28789366		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	30506120, 31172825		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	12721258, 19351823, 19861455, 23444224, 23468873, 23725757, 24488334, 24718984, 25239289, 25914189, 28761362, 29159900, 29904936		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	12721258, 31557970		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	31557970	Associate	★☆☆☆☆ Found in Text Mining only
Neuromyelitis Optica	Neuromyelitis Optica	BEFREE	31796527		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	15983384, 31528121		★☆☆☆☆ Found in Text Mining only
Optic Atrophy	Optic Atrophy	BEFREE	29618326		★☆☆☆☆ Found in Text Mining only
Optic Neuritis	Optic Neuritis	BEFREE	30506120, 31796527		★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	19770515		★☆☆☆☆ Found in Text Mining only
Ovarian Diseases	Ovarian diseases	Pubtator	23029477, 33907841	Associate	★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	29904936		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	20386695, 29620263, 29865033, 33907841	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	19861455, 25914189, 28223795		★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	15983384		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	29483831, 33648511, 37142730, 38124367	Associate	★☆☆☆☆ Found in Text Mining only
Phenylketonurias	Phenylketonuria	BEFREE	31284588		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	22761906, 23333597, 28761362		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	22761906, 23333597, 33934205, 36834602, 38179769, 38226611	Associate	★☆☆☆☆ Found in Text Mining only
Skin Erosion	Skin Erosion	BEFREE	19770515		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	16489064, 19424574		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	23725757, 23963785		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	33315534, 33892811	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of lung	Lung carcinoma	BEFREE	16489064, 18723071		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	23444224		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	27314162		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	27314162	Stimulate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	28069036, 36304254	Associate	★☆☆☆☆ Found in Text Mining only
T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	30854786		★☆☆☆☆ Found in Text Mining only
Thyroid cancer medullary	Medullary thyroid cancer	Pubtator	24488334	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	30665374, 31494045		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	32766313	Associate	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	23873098, 36304254	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Dysplasia	Uterine disease	Pubtator	26624896	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	33728810	Associate	★☆☆☆☆ Found in Text Mining only