FOXC1 (forkhead box C1)

Gene

• Entrez ID: 2296
• Gene name: Forkhead box C1
• Gene symbol: FOXC1
• Synonyms (NCBI Gene): ARA, ASGD3, FKHL7, FREAC-3, FREAC3, IGDA, IHG1, IRID1, RIEG3
• Chromosome: 6
• Chromosome location: 6p25.3
• Summary: This gene belongs to the forkhead family of transcription factors which is characterized by a distinct DNA-binding forkhead domain. The specific function of this gene has not yet been determined; however, it has been shown to play a role in the regulatio

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs35717904	A>T	Pathogenic	3 prime UTR variant
rs77888940	C>A,G,T	Pathogenic	5 prime UTR variant
rs79691946	C>T	Benign, pathogenic	Coding sequence variant, missense variant
rs104893951	T>A,C	Pathogenic	Coding sequence variant, missense variant
rs104893952	C>G,T	Pathogenic	Coding sequence variant, missense variant, stop gained
rs104893953	G>C	Pathogenic	Coding sequence variant, missense variant
rs104893954	C>G	Pathogenic	Coding sequence variant, missense variant
rs104893957	C>T	Pathogenic	Coding sequence variant, missense variant
rs104893958	C>A,G,T	Pathogenic	Coding sequence variant, synonymous variant, missense variant
rs121909338	C>T	Likely-pathogenic, uncertain-significance	Missense variant, coding sequence variant
rs121909339	C>T	Pathogenic	Stop gained, coding sequence variant
rs141798688	C>T	Conflicting-interpretations-of-pathogenicity	Coding sequence variant, synonymous variant
rs185790394	C>G,T	Pathogenic, benign	5 prime UTR variant
rs188085399	G>C	Conflicting-interpretations-of-pathogenicity	Coding sequence variant, synonymous variant
rs368260972	C>G,T	Pathogenic	Coding sequence variant, stop gained, synonymous variant
rs372857241	C>G,T	Pathogenic	Synonymous variant, coding sequence variant, stop gained
rs376405759	C>G,T	Pathogenic	Missense variant, synonymous variant, coding sequence variant
rs483352810	T>G	Pathogenic	Missense variant, coding sequence variant
rs529227054	C>G	Conflicting-interpretations-of-pathogenicity	Coding sequence variant, synonymous variant
rs730882054	CGGCGGCGCGG>-	Pathogenic	Frameshift variant, coding sequence variant
rs756037576	->ACGGCG	Pathogenic	Inframe insertion, coding sequence variant
rs760676014	C>G,T	Pathogenic	Synonymous variant, coding sequence variant, stop gained
rs886039568	C>T	Likely-pathogenic, pathogenic	Coding sequence variant, missense variant
rs886041355	G>A	Pathogenic	Stop gained, coding sequence variant
rs886044143	->A	Pathogenic	Frameshift variant, coding sequence variant
rs1057519471	GGGGGCGGCT>-	Pathogenic	Coding sequence variant, frameshift variant
rs1057519472	CCATGCCG>-	Pathogenic	Coding sequence variant, frameshift variant
rs1057519475	C>T	Pathogenic	Stop gained, coding sequence variant
rs1057519477	G>T	Pathogenic	Stop gained, coding sequence variant
rs1057519478	AGCCCCCGCCCGCGCCGCC>-	Pathogenic	Coding sequence variant, frameshift variant
rs1057519479	CATCCAGGACATCAAG>-	Pathogenic	Coding sequence variant, frameshift variant
rs1057519480	CT>-	Pathogenic	Coding sequence variant, frameshift variant
rs1057519481	AGCGTGGACAACATCATGACGTCGC>-	Pathogenic	Coding sequence variant, frameshift variant
rs1057519482	C>A,T	Pathogenic	Stop gained, coding sequence variant, missense variant
rs1085307508	C>T	Likely-pathogenic	Coding sequence variant, missense variant
rs1085307884	G>A,T	Likely-pathogenic, pathogenic	Coding sequence variant, missense variant
rs1183655796	GCG>-,GCGGCG	Likely-pathogenic	Coding sequence variant, inframe insertion, inframe deletion
rs1241813534	G>-	Pathogenic	Frameshift variant, coding sequence variant
rs1554100953	G>-	Pathogenic	Coding sequence variant, frameshift variant
rs1554100963	GTC>-	Pathogenic	Coding sequence variant, inframe deletion
rs1554101000	G>T	Likely-pathogenic	Stop gained, coding sequence variant
rs1554101058	CGG>GCGC	Likely-pathogenic	Coding sequence variant, frameshift variant
rs1554101076	G>-	Likely-pathogenic	Coding sequence variant, frameshift variant
rs1554101091	CT>-	Pathogenic	Coding sequence variant, frameshift variant
rs1581373410	->T	Pathogenic	Coding sequence variant, frameshift variant
rs1581373693	AGA>-	Likely-pathogenic	Coding sequence variant, inframe deletion
rs1581373773	G>A	Likely-pathogenic	Missense variant, coding sequence variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT006344	hsa-miR-204-5p	Luciferase reporter assay, Western blot	21400511
MIRT006344	hsa-miR-204-5p	Luciferase reporter assay, Western blot	21400511
MIRT006344	hsa-miR-204-5p	Luciferase reporter assay, Western blot	21400511
MIRT006344	hsa-miR-204-5p	Luciferase reporter assay, Western blot	21400511
MIRT006344	hsa-miR-204-5p	Luciferase reporter assay, Western blot	21400511
MIRT006344	hsa-miR-204-5p	Luciferase reporter assay, Western blot	21400511
MIRT006344	hsa-miR-204-5p	Luciferase reporter assay, Western blot	21400511
MIRT006344	hsa-miR-204-5p	Luciferase reporter assay, Western blot	21400511
MIRT006344	hsa-miR-204-5p	Luciferase reporter assay, Western blot	21400511
MIRT006344	hsa-miR-204-5p	Luciferase reporter assay, Western blot	21400511
MIRT006344	hsa-miR-204-5p	Luciferase reporter assay, Western blot	21400511
MIRT006344	hsa-miR-204-5p	Luciferase reporter assay, Western blot	21400511
MIRT006344	hsa-miR-204-5p	Reporter assay	21400511
MIRT043933	hsa-miR-378a-3p	CLASH	23622248
MIRT043069	hsa-miR-324-5p	CLASH	23622248
MIRT041194	hsa-miR-193b-3p	CLASH	23622248
MIRT037280	hsa-miR-877-5p	CLASH	23622248
MIRT036606	hsa-miR-940	CLASH	23622248
MIRT036256	hsa-miR-1236-3p	CLASH	23622248
MIRT438413	hsa-miR-639	Luciferase reporter assay, qRT-PCR, Western blot	25130698
MIRT438413	hsa-miR-639	Luciferase reporter assay, qRT-PCR, Western blot	25130698
MIRT438413	hsa-miR-639	Luciferase reporter assay, qRT-PCR, Western blot	25130698
MIRT438413	hsa-miR-639	Luciferase reporter assay, qRT-PCR, Western blot	25130698
MIRT557834	hsa-miR-6895-5p	PAR-CLIP	20371350
MIRT099065	hsa-miR-4464	PAR-CLIP	20371350
MIRT099066	hsa-miR-4748	PAR-CLIP	20371350
MIRT099064	hsa-miR-329-5p	PAR-CLIP	20371350
MIRT099110	hsa-miR-219a-5p	PAR-CLIP	20371350
MIRT099114	hsa-miR-4782-3p	PAR-CLIP	20371350
MIRT099115	hsa-miR-6766-3p	PAR-CLIP	20371350
MIRT557833	hsa-miR-4433b-5p	PAR-CLIP	20371350
MIRT099113	hsa-miR-4646-3p	PAR-CLIP	20371350
MIRT557834	hsa-miR-6895-5p	PAR-CLIP	20371350
MIRT099065	hsa-miR-4464	PAR-CLIP	20371350
MIRT099066	hsa-miR-4748	PAR-CLIP	20371350
MIRT099064	hsa-miR-329-5p	PAR-CLIP	20371350
MIRT099110	hsa-miR-219a-5p	PAR-CLIP	20371350
MIRT099114	hsa-miR-4782-3p	PAR-CLIP	20371350
MIRT099115	hsa-miR-6766-3p	PAR-CLIP	20371350
MIRT557833	hsa-miR-4433b-5p	PAR-CLIP	20371350
MIRT099113	hsa-miR-4646-3p	PAR-CLIP	20371350
MIRT099050	hsa-miR-552-3p	PAR-CLIP	20371350
MIRT454702	hsa-miR-483-5p	PAR-CLIP	20371350
MIRT316771	hsa-miR-6758-5p	PAR-CLIP	20371350
MIRT316772	hsa-miR-6856-5p	PAR-CLIP	20371350
MIRT099059	hsa-miR-6830-5p	PAR-CLIP	20371350
MIRT099047	hsa-miR-125a-3p	PAR-CLIP	20371350
MIRT099051	hsa-miR-600	PAR-CLIP	20371350
MIRT316769	hsa-miR-3185	PAR-CLIP	20371350
MIRT316766	hsa-miR-605-3p	PAR-CLIP	20371350
MIRT454701	hsa-miR-139-3p	PAR-CLIP	20371350
MIRT316765	hsa-miR-31-5p	PAR-CLIP	20371350
MIRT099058	hsa-miR-6809-5p	PAR-CLIP	20371350
MIRT316768	hsa-miR-3175	PAR-CLIP	20371350
MIRT099054	hsa-miR-5095	PAR-CLIP	20371350
MIRT099060	hsa-miR-7151-3p	PAR-CLIP	20371350
MIRT006344	hsa-miR-204-5p	PAR-CLIP	20371350
MIRT099067	hsa-miR-211-5p	PAR-CLIP	20371350
MIRT316775	hsa-miR-548e-5p	PAR-CLIP	20371350
MIRT316778	hsa-miR-6835-3p	PAR-CLIP	20371350
MIRT316777	hsa-miR-548at-5p	PAR-CLIP	20371350
MIRT316774	hsa-miR-561-3p	PAR-CLIP	20371350
MIRT316776	hsa-miR-4742-5p	PAR-CLIP	20371350
MIRT567522	hsa-miR-4269	PAR-CLIP	20371350
MIRT567521	hsa-miR-6715b-5p	PAR-CLIP	20371350
MIRT567520	hsa-miR-4514	PAR-CLIP	20371350
MIRT567519	hsa-miR-4692	PAR-CLIP	20371350
MIRT099075	hsa-miR-6832-3p	PAR-CLIP	20371350
MIRT567518	hsa-miR-1292-5p	PAR-CLIP	20371350
MIRT567517	hsa-miR-4471	PAR-CLIP	20371350
MIRT567516	hsa-miR-8059	PAR-CLIP	20371350
MIRT260591	hsa-miR-374a-5p	PAR-CLIP	20371350
MIRT260596	hsa-miR-374b-5p	PAR-CLIP	20371350
MIRT099069	hsa-miR-623	PAR-CLIP	20371350
MIRT099073	hsa-miR-4755-5p	PAR-CLIP	20371350
MIRT099074	hsa-miR-5006-3p	PAR-CLIP	20371350
MIRT099063	hsa-miR-450a-1-3p	PAR-CLIP	20371350
MIRT567515	hsa-miR-3122	PAR-CLIP	20371350
MIRT567514	hsa-miR-3913-5p	PAR-CLIP	20371350
MIRT567513	hsa-miR-887-5p	PAR-CLIP	20371350
MIRT567512	hsa-miR-6513-5p	PAR-CLIP	20371350
MIRT099072	hsa-miR-4446-5p	PAR-CLIP	20371350
MIRT567511	hsa-miR-495-3p	PAR-CLIP	20371350
MIRT567510	hsa-miR-5688	PAR-CLIP	20371350
MIRT316786	hsa-miR-32-3p	PAR-CLIP	20371350
MIRT567509	hsa-miR-6758-3p	PAR-CLIP	20371350
MIRT316788	hsa-miR-4790-3p	PAR-CLIP	20371350
MIRT316787	hsa-miR-4477a	PAR-CLIP	20371350
MIRT567508	hsa-miR-6715b-3p	PAR-CLIP	20371350
MIRT557834	hsa-miR-6895-5p	PAR-CLIP	20371350
MIRT099065	hsa-miR-4464	PAR-CLIP	20371350
MIRT099066	hsa-miR-4748	PAR-CLIP	20371350
MIRT099064	hsa-miR-329-5p	PAR-CLIP	20371350
MIRT099112	hsa-miR-3607-3p	PAR-CLIP	20371350
MIRT099110	hsa-miR-219a-5p	PAR-CLIP	20371350
MIRT099114	hsa-miR-4782-3p	PAR-CLIP	20371350
MIRT099115	hsa-miR-6766-3p	PAR-CLIP	20371350
MIRT557833	hsa-miR-4433b-5p	PAR-CLIP	20371350
MIRT099113	hsa-miR-4646-3p	PAR-CLIP	20371350
MIRT557834	hsa-miR-6895-5p	PAR-CLIP	20371350
MIRT099065	hsa-miR-4464	PAR-CLIP	20371350
MIRT099066	hsa-miR-4748	PAR-CLIP	20371350
MIRT099064	hsa-miR-329-5p	PAR-CLIP	20371350
MIRT099110	hsa-miR-219a-5p	PAR-CLIP	20371350
MIRT099114	hsa-miR-4782-3p	PAR-CLIP	20371350
MIRT099115	hsa-miR-6766-3p	PAR-CLIP	20371350
MIRT557833	hsa-miR-4433b-5p	PAR-CLIP	20371350
MIRT099113	hsa-miR-4646-3p	PAR-CLIP	20371350
MIRT557834	hsa-miR-6895-5p	PAR-CLIP	21572407
MIRT099065	hsa-miR-4464	PAR-CLIP	21572407
MIRT099066	hsa-miR-4748	PAR-CLIP	21572407
MIRT099064	hsa-miR-329-5p	PAR-CLIP	21572407
MIRT099112	hsa-miR-3607-3p	PAR-CLIP	21572407
MIRT099110	hsa-miR-219a-5p	PAR-CLIP	21572407
MIRT099114	hsa-miR-4782-3p	PAR-CLIP	21572407
MIRT099115	hsa-miR-6766-3p	PAR-CLIP	21572407
MIRT557833	hsa-miR-4433b-5p	PAR-CLIP	21572407
MIRT099113	hsa-miR-4646-3p	PAR-CLIP	21572407
MIRT257295	hsa-miR-3609	PAR-CLIP	21572407
MIRT257297	hsa-miR-548ah-5p	PAR-CLIP	21572407
MIRT257281	hsa-miR-106a-5p	PAR-CLIP	21572407
MIRT257283	hsa-miR-106b-5p	PAR-CLIP	21572407
MIRT257278	hsa-miR-17-5p	PAR-CLIP	21572407
MIRT257279	hsa-miR-20a-5p	PAR-CLIP	21572407
MIRT257287	hsa-miR-20b-5p	PAR-CLIP	21572407
MIRT257289	hsa-miR-519d-3p	PAR-CLIP	21572407
MIRT257288	hsa-miR-526b-3p	PAR-CLIP	21572407
MIRT257280	hsa-miR-93-5p	PAR-CLIP	21572407
MIRT257298	hsa-miR-4796-3p	PAR-CLIP	21572407
MIRT257290	hsa-miR-500a-5p	PAR-CLIP	21572407
MIRT257291	hsa-miR-501-5p	PAR-CLIP	21572407
MIRT257285	hsa-miR-302b-5p	PAR-CLIP	21572407
MIRT257286	hsa-miR-302d-5p	PAR-CLIP	21572407
MIRT548182	hsa-miR-4513	PAR-CLIP	21572407
MIRT548183	hsa-miR-6855-3p	PAR-CLIP	21572407
MIRT548181	hsa-miR-6857-3p	PAR-CLIP	21572407
MIRT540052	hsa-miR-103a-3p	PAR-CLIP	21572407
MIRT540051	hsa-miR-107	PAR-CLIP	21572407
MIRT257282	hsa-miR-223-5p	PAR-CLIP	21572407
MIRT548180	hsa-miR-3136-5p	PAR-CLIP	21572407
MIRT548178	hsa-miR-4439	PAR-CLIP	21572407
MIRT548179	hsa-miR-943	PAR-CLIP	21572407
MIRT540050	hsa-miR-7156-3p	PAR-CLIP	21572407
MIRT540049	hsa-miR-1301-3p	PAR-CLIP	21572407
MIRT540048	hsa-miR-5047	PAR-CLIP	21572407
MIRT540047	hsa-miR-302c-5p	PAR-CLIP	21572407
MIRT540046	hsa-miR-6516-5p	PAR-CLIP	21572407
MIRT257295	hsa-miR-3609	PAR-CLIP	21572407
MIRT257297	hsa-miR-548ah-5p	PAR-CLIP	21572407
MIRT257281	hsa-miR-106a-5p	PAR-CLIP	21572407
MIRT257283	hsa-miR-106b-5p	PAR-CLIP	21572407
MIRT257278	hsa-miR-17-5p	PAR-CLIP	21572407
MIRT257279	hsa-miR-20a-5p	PAR-CLIP	21572407
MIRT257287	hsa-miR-20b-5p	PAR-CLIP	21572407
MIRT257289	hsa-miR-519d-3p	PAR-CLIP	21572407
MIRT257288	hsa-miR-526b-3p	PAR-CLIP	21572407
MIRT257280	hsa-miR-93-5p	PAR-CLIP	21572407
MIRT257298	hsa-miR-4796-3p	PAR-CLIP	21572407
MIRT548182	hsa-miR-4513	PAR-CLIP	21572407
MIRT548183	hsa-miR-6855-3p	PAR-CLIP	21572407
MIRT548181	hsa-miR-6857-3p	PAR-CLIP	21572407
MIRT540052	hsa-miR-103a-3p	PAR-CLIP	21572407
MIRT540051	hsa-miR-107	PAR-CLIP	21572407
MIRT257282	hsa-miR-223-5p	PAR-CLIP	21572407
MIRT548180	hsa-miR-3136-5p	PAR-CLIP	21572407
MIRT548178	hsa-miR-4439	PAR-CLIP	21572407
MIRT548179	hsa-miR-943	PAR-CLIP	21572407
MIRT540050	hsa-miR-7156-3p	PAR-CLIP	21572407
MIRT540049	hsa-miR-1301-3p	PAR-CLIP	21572407
MIRT540048	hsa-miR-5047	PAR-CLIP	21572407
MIRT540046	hsa-miR-6516-5p	PAR-CLIP	21572407
MIRT257295	hsa-miR-3609	PAR-CLIP	21572407
MIRT257297	hsa-miR-548ah-5p	PAR-CLIP	21572407
MIRT257281	hsa-miR-106a-5p	PAR-CLIP	21572407
MIRT257283	hsa-miR-106b-5p	PAR-CLIP	21572407
MIRT257278	hsa-miR-17-5p	PAR-CLIP	21572407
MIRT257279	hsa-miR-20a-5p	PAR-CLIP	21572407
MIRT257287	hsa-miR-20b-5p	PAR-CLIP	21572407
MIRT257289	hsa-miR-519d-3p	PAR-CLIP	21572407
MIRT257288	hsa-miR-526b-3p	PAR-CLIP	21572407
MIRT257280	hsa-miR-93-5p	PAR-CLIP	21572407
MIRT257298	hsa-miR-4796-3p	PAR-CLIP	21572407
MIRT257290	hsa-miR-500a-5p	PAR-CLIP	21572407
MIRT257291	hsa-miR-501-5p	PAR-CLIP	21572407
MIRT257285	hsa-miR-302b-5p	PAR-CLIP	21572407
MIRT257286	hsa-miR-302d-5p	PAR-CLIP	21572407
MIRT540052	hsa-miR-103a-3p	PAR-CLIP	21572407
MIRT540051	hsa-miR-107	PAR-CLIP	21572407
MIRT257282	hsa-miR-223-5p	PAR-CLIP	21572407
MIRT540050	hsa-miR-7156-3p	PAR-CLIP	21572407
MIRT540049	hsa-miR-1301-3p	PAR-CLIP	21572407
MIRT540048	hsa-miR-5047	PAR-CLIP	21572407
MIRT540047	hsa-miR-302c-5p	PAR-CLIP	21572407
MIRT540046	hsa-miR-6516-5p	PAR-CLIP	21572407
MIRT454702	hsa-miR-483-5p	PAR-CLIP	23592263
MIRT316771	hsa-miR-6758-5p	PAR-CLIP	23592263
MIRT316772	hsa-miR-6856-5p	PAR-CLIP	23592263
MIRT483142	hsa-miR-4779	PAR-CLIP	23592263
MIRT483141	hsa-miR-6783-5p	PAR-CLIP	23592263
MIRT454701	hsa-miR-139-3p	PAR-CLIP	23592263
MIRT483140	hsa-miR-765	PAR-CLIP	23592263
MIRT483139	hsa-miR-3153	PAR-CLIP	23592263
MIRT483138	hsa-miR-6733-5p	PAR-CLIP	23592263
MIRT483137	hsa-miR-6739-5p	PAR-CLIP	23592263
MIRT483136	hsa-miR-7106-5p	PAR-CLIP	23592263
MIRT316768	hsa-miR-3175	PAR-CLIP	23592263
MIRT099050	hsa-miR-552-3p	PAR-CLIP	23592263
MIRT454702	hsa-miR-483-5p	PAR-CLIP	23592263
MIRT316771	hsa-miR-6758-5p	PAR-CLIP	23592263
MIRT316772	hsa-miR-6856-5p	PAR-CLIP	23592263
MIRT483142	hsa-miR-4779	PAR-CLIP	23592263
MIRT483141	hsa-miR-6783-5p	PAR-CLIP	23592263
MIRT099048	hsa-miR-200a-5p	PAR-CLIP	23592263
MIRT099046	hsa-miR-200b-5p	PAR-CLIP	23592263
MIRT099059	hsa-miR-6830-5p	PAR-CLIP	23592263
MIRT099047	hsa-miR-125a-3p	PAR-CLIP	23592263
MIRT099051	hsa-miR-600	PAR-CLIP	23592263
MIRT316769	hsa-miR-3185	PAR-CLIP	23592263
MIRT316766	hsa-miR-605-3p	PAR-CLIP	23592263
MIRT454701	hsa-miR-139-3p	PAR-CLIP	23592263
MIRT483140	hsa-miR-765	PAR-CLIP	23592263
MIRT316765	hsa-miR-31-5p	PAR-CLIP	23592263
MIRT099058	hsa-miR-6809-5p	PAR-CLIP	23592263
MIRT483139	hsa-miR-3153	PAR-CLIP	23592263
MIRT483138	hsa-miR-6733-5p	PAR-CLIP	23592263
MIRT483137	hsa-miR-6739-5p	PAR-CLIP	23592263
MIRT483136	hsa-miR-7106-5p	PAR-CLIP	23592263
MIRT316768	hsa-miR-3175	PAR-CLIP	23592263
MIRT099054	hsa-miR-5095	PAR-CLIP	23592263
MIRT099060	hsa-miR-7151-3p	PAR-CLIP	23592263
MIRT099050	hsa-miR-552-3p	PAR-CLIP	23592263
MIRT454702	hsa-miR-483-5p	PAR-CLIP	23592263
MIRT316771	hsa-miR-6758-5p	PAR-CLIP	23592263
MIRT316772	hsa-miR-6856-5p	PAR-CLIP	23592263
MIRT099048	hsa-miR-200a-5p	PAR-CLIP	23592263
MIRT099046	hsa-miR-200b-5p	PAR-CLIP	23592263
MIRT099059	hsa-miR-6830-5p	PAR-CLIP	23592263
MIRT099047	hsa-miR-125a-3p	PAR-CLIP	23592263
MIRT099051	hsa-miR-600	PAR-CLIP	23592263
MIRT316769	hsa-miR-3185	PAR-CLIP	23592263
MIRT316766	hsa-miR-605-3p	PAR-CLIP	23592263
MIRT454701	hsa-miR-139-3p	PAR-CLIP	23592263
MIRT316765	hsa-miR-31-5p	PAR-CLIP	23592263
MIRT099058	hsa-miR-6809-5p	PAR-CLIP	23592263
MIRT316768	hsa-miR-3175	PAR-CLIP	23592263
MIRT099054	hsa-miR-5095	PAR-CLIP	23592263
MIRT099060	hsa-miR-7151-3p	PAR-CLIP	23592263
MIRT316740	hsa-miR-4792	Luciferase reporter assay, qRT-PCR, Western blot	26585487
MIRT316740	hsa-miR-4792	Luciferase reporter assay, qRT-PCR, Western blot	26585487
MIRT731845	hsa-miR-138-5p	Luciferase reporter assay, qRT-PCR, Western blot	27799147
MIRT731845	hsa-miR-138-5p	Luciferase reporter assay, qRT-PCR, Western blot	27799147
MIRT567511	hsa-miR-495-3p	GFP reporter assay, qRT-PCR, Western blot	26198045
MIRT567511	hsa-miR-495-3p	GFP reporter assay, qRT-PCR, Western blot	26198045
MIRT567511	hsa-miR-495-3p	GFP reporter assay, qRT-PCR, Western blot	26198045
MIRT099047	hsa-miR-125a-3p	PAR-CLIP	26701625
MIRT099047	hsa-miR-125a-3p	PAR-CLIP	26701625
MIRT099047	hsa-miR-125a-3p	PAR-CLIP	26701625
MIRT099047	hsa-miR-125a-3p	PAR-CLIP	26701625
MIRT099047	hsa-miR-125a-3p	PAR-CLIP	26701625
MIRT099047	hsa-miR-125a-3p	PAR-CLIP	26701625
MIRT099047	hsa-miR-125a-3p	PAR-CLIP	26701625
MIRT099047	hsa-miR-125a-3p	PAR-CLIP	26701625
MIRT099047	hsa-miR-125a-3p	PAR-CLIP	26701625
MIRT099047	hsa-miR-125a-3p	PAR-CLIP	26701625
MIRT099047	hsa-miR-125a-3p	PAR-CLIP	26701625
MIRT099047	hsa-miR-125a-3p	PAR-CLIP	26701625
MIRT099047	hsa-miR-125a-3p	PAR-CLIP	26701625
MIRT454701	hsa-miR-139-3p	PAR-CLIP	26701625
MIRT454701	hsa-miR-139-3p	PAR-CLIP	26701625
MIRT454701	hsa-miR-139-3p	PAR-CLIP	26701625
MIRT454701	hsa-miR-139-3p	PAR-CLIP	26701625
MIRT454701	hsa-miR-139-3p	PAR-CLIP	26701625
MIRT454701	hsa-miR-139-3p	PAR-CLIP	26701625
MIRT454701	hsa-miR-139-3p	PAR-CLIP	26701625
MIRT454701	hsa-miR-139-3p	PAR-CLIP	26701625
MIRT454701	hsa-miR-139-3p	PAR-CLIP	26701625
MIRT454701	hsa-miR-139-3p	PAR-CLIP	26701625
MIRT454701	hsa-miR-139-3p	PAR-CLIP	26701625
MIRT454701	hsa-miR-139-3p	PAR-CLIP	26701625
MIRT454701	hsa-miR-139-3p	PAR-CLIP	26701625
MIRT099048	hsa-miR-200a-5p	PAR-CLIP	26701625
MIRT099048	hsa-miR-200a-5p	PAR-CLIP	26701625
MIRT099048	hsa-miR-200a-5p	PAR-CLIP	26701625
MIRT099048	hsa-miR-200a-5p	PAR-CLIP	26701625
MIRT099048	hsa-miR-200a-5p	PAR-CLIP	26701625
MIRT099048	hsa-miR-200a-5p	PAR-CLIP	26701625
MIRT099048	hsa-miR-200a-5p	PAR-CLIP	26701625
MIRT099048	hsa-miR-200a-5p	PAR-CLIP	26701625
MIRT099048	hsa-miR-200a-5p	PAR-CLIP	26701625
MIRT099048	hsa-miR-200a-5p	PAR-CLIP	26701625
MIRT099048	hsa-miR-200a-5p	PAR-CLIP	26701625
MIRT099046	hsa-miR-200b-5p	PAR-CLIP	26701625
MIRT099046	hsa-miR-200b-5p	PAR-CLIP	26701625
MIRT099046	hsa-miR-200b-5p	PAR-CLIP	26701625
MIRT099046	hsa-miR-200b-5p	PAR-CLIP	26701625
MIRT099046	hsa-miR-200b-5p	PAR-CLIP	26701625
MIRT099046	hsa-miR-200b-5p	PAR-CLIP	26701625
MIRT099046	hsa-miR-200b-5p	PAR-CLIP	26701625
MIRT099046	hsa-miR-200b-5p	PAR-CLIP	26701625
MIRT099046	hsa-miR-200b-5p	PAR-CLIP	26701625
MIRT099046	hsa-miR-200b-5p	PAR-CLIP	26701625
MIRT099046	hsa-miR-200b-5p	PAR-CLIP	26701625
MIRT483139	hsa-miR-3153	PAR-CLIP	26701625
MIRT483139	hsa-miR-3153	PAR-CLIP	26701625
MIRT483139	hsa-miR-3153	PAR-CLIP	26701625
MIRT483139	hsa-miR-3153	PAR-CLIP	26701625
MIRT483139	hsa-miR-3153	PAR-CLIP	26701625
MIRT316765	hsa-miR-31-5p	PAR-CLIP	26701625
MIRT316765	hsa-miR-31-5p	PAR-CLIP	26701625
MIRT316765	hsa-miR-31-5p	PAR-CLIP	26701625
MIRT316765	hsa-miR-31-5p	PAR-CLIP	26701625
MIRT316765	hsa-miR-31-5p	PAR-CLIP	26701625
MIRT316765	hsa-miR-31-5p	PAR-CLIP	26701625
MIRT316765	hsa-miR-31-5p	PAR-CLIP	26701625
MIRT316765	hsa-miR-31-5p	PAR-CLIP	26701625
MIRT316765	hsa-miR-31-5p	PAR-CLIP	26701625
MIRT316765	hsa-miR-31-5p	PAR-CLIP	26701625
MIRT316765	hsa-miR-31-5p	PAR-CLIP	26701625
MIRT316765	hsa-miR-31-5p	PAR-CLIP	26701625
MIRT316765	hsa-miR-31-5p	PAR-CLIP	26701625
MIRT316768	hsa-miR-3175	PAR-CLIP	26701625
MIRT316768	hsa-miR-3175	PAR-CLIP	26701625
MIRT316768	hsa-miR-3175	PAR-CLIP	26701625
MIRT316768	hsa-miR-3175	PAR-CLIP	26701625
MIRT316768	hsa-miR-3175	PAR-CLIP	26701625
MIRT316768	hsa-miR-3175	PAR-CLIP	26701625
MIRT316768	hsa-miR-3175	PAR-CLIP	26701625
MIRT316768	hsa-miR-3175	PAR-CLIP	26701625
MIRT316768	hsa-miR-3175	PAR-CLIP	26701625
MIRT316768	hsa-miR-3175	PAR-CLIP	26701625
MIRT316768	hsa-miR-3175	PAR-CLIP	26701625
MIRT316768	hsa-miR-3175	PAR-CLIP	26701625
MIRT316768	hsa-miR-3175	PAR-CLIP	26701625
MIRT316769	hsa-miR-3185	PAR-CLIP	26701625
MIRT316769	hsa-miR-3185	PAR-CLIP	26701625
MIRT316769	hsa-miR-3185	PAR-CLIP	26701625
MIRT316769	hsa-miR-3185	PAR-CLIP	26701625
MIRT316769	hsa-miR-3185	PAR-CLIP	26701625
MIRT316769	hsa-miR-3185	PAR-CLIP	26701625
MIRT316769	hsa-miR-3185	PAR-CLIP	26701625
MIRT316769	hsa-miR-3185	PAR-CLIP	26701625
MIRT316769	hsa-miR-3185	PAR-CLIP	26701625
MIRT316769	hsa-miR-3185	PAR-CLIP	26701625
MIRT316769	hsa-miR-3185	PAR-CLIP	26701625
MIRT316769	hsa-miR-3185	PAR-CLIP	26701625
MIRT316769	hsa-miR-3185	PAR-CLIP	26701625
MIRT483142	hsa-miR-4779	PAR-CLIP	26701625
MIRT483142	hsa-miR-4779	PAR-CLIP	26701625
MIRT483142	hsa-miR-4779	PAR-CLIP	26701625
MIRT483142	hsa-miR-4779	PAR-CLIP	26701625
MIRT483142	hsa-miR-4779	PAR-CLIP	26701625
MIRT454702	hsa-miR-483-5p	PAR-CLIP	26701625
MIRT454702	hsa-miR-483-5p	PAR-CLIP	26701625
MIRT454702	hsa-miR-483-5p	PAR-CLIP	26701625
MIRT454702	hsa-miR-483-5p	PAR-CLIP	26701625
MIRT454702	hsa-miR-483-5p	PAR-CLIP	26701625
MIRT454702	hsa-miR-483-5p	PAR-CLIP	26701625
MIRT454702	hsa-miR-483-5p	PAR-CLIP	26701625
MIRT454702	hsa-miR-483-5p	PAR-CLIP	26701625
MIRT454702	hsa-miR-483-5p	PAR-CLIP	26701625
MIRT454702	hsa-miR-483-5p	PAR-CLIP	26701625
MIRT454702	hsa-miR-483-5p	PAR-CLIP	26701625
MIRT454702	hsa-miR-483-5p	PAR-CLIP	26701625
MIRT454702	hsa-miR-483-5p	PAR-CLIP	26701625
MIRT099054	hsa-miR-5095	PAR-CLIP	26701625
MIRT099054	hsa-miR-5095	PAR-CLIP	26701625
MIRT099054	hsa-miR-5095	PAR-CLIP	26701625
MIRT099054	hsa-miR-5095	PAR-CLIP	26701625
MIRT099054	hsa-miR-5095	PAR-CLIP	26701625
MIRT099054	hsa-miR-5095	PAR-CLIP	26701625
MIRT099054	hsa-miR-5095	PAR-CLIP	26701625
MIRT099054	hsa-miR-5095	PAR-CLIP	26701625
MIRT099054	hsa-miR-5095	PAR-CLIP	26701625
MIRT099054	hsa-miR-5095	PAR-CLIP	26701625
MIRT099054	hsa-miR-5095	PAR-CLIP	26701625
MIRT099054	hsa-miR-5095	PAR-CLIP	26701625
MIRT099054	hsa-miR-5095	PAR-CLIP	26701625
MIRT099050	hsa-miR-552-3p	PAR-CLIP	26701625
MIRT099050	hsa-miR-552-3p	PAR-CLIP	26701625
MIRT099050	hsa-miR-552-3p	PAR-CLIP	26701625
MIRT099050	hsa-miR-552-3p	PAR-CLIP	26701625
MIRT099050	hsa-miR-552-3p	PAR-CLIP	26701625
MIRT099050	hsa-miR-552-3p	PAR-CLIP	26701625
MIRT099050	hsa-miR-552-3p	PAR-CLIP	26701625
MIRT099050	hsa-miR-552-3p	PAR-CLIP	26701625
MIRT099050	hsa-miR-552-3p	PAR-CLIP	26701625
MIRT099050	hsa-miR-552-3p	PAR-CLIP	26701625
MIRT099050	hsa-miR-552-3p	PAR-CLIP	26701625
MIRT099050	hsa-miR-552-3p	PAR-CLIP	26701625
MIRT099050	hsa-miR-552-3p	PAR-CLIP	26701625
MIRT099051	hsa-miR-600	PAR-CLIP	26701625
MIRT099051	hsa-miR-600	PAR-CLIP	26701625
MIRT099051	hsa-miR-600	PAR-CLIP	26701625
MIRT099051	hsa-miR-600	PAR-CLIP	26701625
MIRT099051	hsa-miR-600	PAR-CLIP	26701625
MIRT099051	hsa-miR-600	PAR-CLIP	26701625
MIRT099051	hsa-miR-600	PAR-CLIP	26701625
MIRT099051	hsa-miR-600	PAR-CLIP	26701625
MIRT099051	hsa-miR-600	PAR-CLIP	26701625
MIRT099051	hsa-miR-600	PAR-CLIP	26701625
MIRT099051	hsa-miR-600	PAR-CLIP	26701625
MIRT099051	hsa-miR-600	PAR-CLIP	26701625
MIRT099051	hsa-miR-600	PAR-CLIP	26701625
MIRT316766	hsa-miR-605-3p	PAR-CLIP	26701625
MIRT316766	hsa-miR-605-3p	PAR-CLIP	26701625
MIRT316766	hsa-miR-605-3p	PAR-CLIP	26701625
MIRT316766	hsa-miR-605-3p	PAR-CLIP	26701625
MIRT316766	hsa-miR-605-3p	PAR-CLIP	26701625
MIRT316766	hsa-miR-605-3p	PAR-CLIP	26701625
MIRT316766	hsa-miR-605-3p	PAR-CLIP	26701625
MIRT316766	hsa-miR-605-3p	PAR-CLIP	26701625
MIRT316766	hsa-miR-605-3p	PAR-CLIP	26701625
MIRT316766	hsa-miR-605-3p	PAR-CLIP	26701625
MIRT316766	hsa-miR-605-3p	PAR-CLIP	26701625
MIRT316766	hsa-miR-605-3p	PAR-CLIP	26701625
MIRT316766	hsa-miR-605-3p	PAR-CLIP	26701625
MIRT483138	hsa-miR-6733-5p	PAR-CLIP	26701625
MIRT483138	hsa-miR-6733-5p	PAR-CLIP	26701625
MIRT483138	hsa-miR-6733-5p	PAR-CLIP	26701625
MIRT483138	hsa-miR-6733-5p	PAR-CLIP	26701625
MIRT483138	hsa-miR-6733-5p	PAR-CLIP	26701625
MIRT483137	hsa-miR-6739-5p	PAR-CLIP	26701625
MIRT483137	hsa-miR-6739-5p	PAR-CLIP	26701625
MIRT483137	hsa-miR-6739-5p	PAR-CLIP	26701625
MIRT483137	hsa-miR-6739-5p	PAR-CLIP	26701625
MIRT483137	hsa-miR-6739-5p	PAR-CLIP	26701625
MIRT316771	hsa-miR-6758-5p	PAR-CLIP	26701625
MIRT316771	hsa-miR-6758-5p	PAR-CLIP	26701625
MIRT316771	hsa-miR-6758-5p	PAR-CLIP	26701625
MIRT316771	hsa-miR-6758-5p	PAR-CLIP	26701625
MIRT316771	hsa-miR-6758-5p	PAR-CLIP	26701625
MIRT316771	hsa-miR-6758-5p	PAR-CLIP	26701625
MIRT316771	hsa-miR-6758-5p	PAR-CLIP	26701625
MIRT316771	hsa-miR-6758-5p	PAR-CLIP	26701625
MIRT316771	hsa-miR-6758-5p	PAR-CLIP	26701625
MIRT316771	hsa-miR-6758-5p	PAR-CLIP	26701625
MIRT316771	hsa-miR-6758-5p	PAR-CLIP	26701625
MIRT316771	hsa-miR-6758-5p	PAR-CLIP	26701625
MIRT316771	hsa-miR-6758-5p	PAR-CLIP	26701625
MIRT483141	hsa-miR-6783-5p	PAR-CLIP	26701625
MIRT483141	hsa-miR-6783-5p	PAR-CLIP	26701625
MIRT483141	hsa-miR-6783-5p	PAR-CLIP	26701625
MIRT483141	hsa-miR-6783-5p	PAR-CLIP	26701625
MIRT483141	hsa-miR-6783-5p	PAR-CLIP	26701625
MIRT099058	hsa-miR-6809-5p	PAR-CLIP	26701625
MIRT099058	hsa-miR-6809-5p	PAR-CLIP	26701625
MIRT099058	hsa-miR-6809-5p	PAR-CLIP	26701625
MIRT099058	hsa-miR-6809-5p	PAR-CLIP	26701625
MIRT099058	hsa-miR-6809-5p	PAR-CLIP	26701625
MIRT099058	hsa-miR-6809-5p	PAR-CLIP	26701625
MIRT099058	hsa-miR-6809-5p	PAR-CLIP	26701625
MIRT099058	hsa-miR-6809-5p	PAR-CLIP	26701625
MIRT099058	hsa-miR-6809-5p	PAR-CLIP	26701625
MIRT099058	hsa-miR-6809-5p	PAR-CLIP	26701625
MIRT099058	hsa-miR-6809-5p	PAR-CLIP	26701625
MIRT099058	hsa-miR-6809-5p	PAR-CLIP	26701625
MIRT099058	hsa-miR-6809-5p	PAR-CLIP	26701625
MIRT099059	hsa-miR-6830-5p	PAR-CLIP	26701625
MIRT099059	hsa-miR-6830-5p	PAR-CLIP	26701625
MIRT099059	hsa-miR-6830-5p	PAR-CLIP	26701625
MIRT099059	hsa-miR-6830-5p	PAR-CLIP	26701625
MIRT099059	hsa-miR-6830-5p	PAR-CLIP	26701625
MIRT099059	hsa-miR-6830-5p	PAR-CLIP	26701625
MIRT099059	hsa-miR-6830-5p	PAR-CLIP	26701625
MIRT099059	hsa-miR-6830-5p	PAR-CLIP	26701625
MIRT099059	hsa-miR-6830-5p	PAR-CLIP	26701625
MIRT099059	hsa-miR-6830-5p	PAR-CLIP	26701625
MIRT099059	hsa-miR-6830-5p	PAR-CLIP	26701625
MIRT099059	hsa-miR-6830-5p	PAR-CLIP	26701625
MIRT099059	hsa-miR-6830-5p	PAR-CLIP	26701625
MIRT316772	hsa-miR-6856-5p	PAR-CLIP	26701625
MIRT316772	hsa-miR-6856-5p	PAR-CLIP	26701625
MIRT316772	hsa-miR-6856-5p	PAR-CLIP	26701625
MIRT316772	hsa-miR-6856-5p	PAR-CLIP	26701625
MIRT316772	hsa-miR-6856-5p	PAR-CLIP	26701625
MIRT316772	hsa-miR-6856-5p	PAR-CLIP	26701625
MIRT316772	hsa-miR-6856-5p	PAR-CLIP	26701625
MIRT316772	hsa-miR-6856-5p	PAR-CLIP	26701625
MIRT316772	hsa-miR-6856-5p	PAR-CLIP	26701625
MIRT316772	hsa-miR-6856-5p	PAR-CLIP	26701625
MIRT316772	hsa-miR-6856-5p	PAR-CLIP	26701625
MIRT316772	hsa-miR-6856-5p	PAR-CLIP	26701625
MIRT316772	hsa-miR-6856-5p	PAR-CLIP	26701625
MIRT483136	hsa-miR-7106-5p	PAR-CLIP	26701625
MIRT483136	hsa-miR-7106-5p	PAR-CLIP	26701625
MIRT483136	hsa-miR-7106-5p	PAR-CLIP	26701625
MIRT483136	hsa-miR-7106-5p	PAR-CLIP	26701625
MIRT483136	hsa-miR-7106-5p	PAR-CLIP	26701625
MIRT483136	hsa-miR-7106-5p	PAR-CLIP	26701625
MIRT099060	hsa-miR-7151-3p	PAR-CLIP	26701625
MIRT099060	hsa-miR-7151-3p	PAR-CLIP	26701625
MIRT099060	hsa-miR-7151-3p	PAR-CLIP	26701625
MIRT099060	hsa-miR-7151-3p	PAR-CLIP	26701625
MIRT099060	hsa-miR-7151-3p	PAR-CLIP	26701625
MIRT099060	hsa-miR-7151-3p	PAR-CLIP	26701625
MIRT099060	hsa-miR-7151-3p	PAR-CLIP	26701625
MIRT099060	hsa-miR-7151-3p	PAR-CLIP	26701625
MIRT099060	hsa-miR-7151-3p	PAR-CLIP	26701625
MIRT099060	hsa-miR-7151-3p	PAR-CLIP	26701625
MIRT099060	hsa-miR-7151-3p	PAR-CLIP	26701625
MIRT099060	hsa-miR-7151-3p	PAR-CLIP	26701625
MIRT099060	hsa-miR-7151-3p	PAR-CLIP	26701625
MIRT483140	hsa-miR-765	PAR-CLIP	26701625
MIRT483140	hsa-miR-765	PAR-CLIP	26701625
MIRT483140	hsa-miR-765	PAR-CLIP	26701625
MIRT483140	hsa-miR-765	PAR-CLIP	26701625
MIRT483140	hsa-miR-765	PAR-CLIP	26701625
MIRT483140	hsa-miR-765	PAR-CLIP	26701625
MIRT438413	hsa-miR-639	Immunohistochemistry (IHC), Luciferase reporter assay, RNA-seq, qRT-PCR	34034740
MIRT731845	hsa-miR-138-5p	Immunohistochemistry (IHC), Luciferase reporter assay, qRT-PCR, Western blotting	31783879
MIRT731845	hsa-miR-138-5p	Immunohistochemistry (IHC), Luciferase reporter assay, qRT-PCR, Western blotting	31783879
MIRT557834	hsa-miR-6895-5p	PAR-CLIP	20371350
MIRT099065	hsa-miR-4464	PAR-CLIP	20371350
MIRT099066	hsa-miR-4748	PAR-CLIP	20371350
MIRT099064	hsa-miR-329-5p	PAR-CLIP	20371350
MIRT099110	hsa-miR-219a-5p	PAR-CLIP	20371350
MIRT099114	hsa-miR-4782-3p	PAR-CLIP	20371350
MIRT099115	hsa-miR-6766-3p	PAR-CLIP	20371350
MIRT557833	hsa-miR-4433b-5p	PAR-CLIP	20371350
MIRT099113	hsa-miR-4646-3p	PAR-CLIP	20371350
MIRT557834	hsa-miR-6895-5p	PAR-CLIP	20371350
MIRT099065	hsa-miR-4464	PAR-CLIP	20371350
MIRT099066	hsa-miR-4748	PAR-CLIP	20371350
MIRT099064	hsa-miR-329-5p	PAR-CLIP	20371350
MIRT099110	hsa-miR-219a-5p	PAR-CLIP	20371350
MIRT099114	hsa-miR-4782-3p	PAR-CLIP	20371350
MIRT099115	hsa-miR-6766-3p	PAR-CLIP	20371350
MIRT557833	hsa-miR-4433b-5p	PAR-CLIP	20371350
MIRT099113	hsa-miR-4646-3p	PAR-CLIP	20371350
MIRT099050	hsa-miR-552-3p	PAR-CLIP	20371350
MIRT454702	hsa-miR-483-5p	PAR-CLIP	20371350
MIRT316771	hsa-miR-6758-5p	PAR-CLIP	20371350
MIRT316772	hsa-miR-6856-5p	PAR-CLIP	20371350
MIRT099059	hsa-miR-6830-5p	PAR-CLIP	20371350
MIRT099047	hsa-miR-125a-3p	PAR-CLIP	20371350
MIRT099051	hsa-miR-600	PAR-CLIP	20371350
MIRT316769	hsa-miR-3185	PAR-CLIP	20371350
MIRT316766	hsa-miR-605-3p	PAR-CLIP	20371350
MIRT454701	hsa-miR-139-3p	PAR-CLIP	20371350
MIRT316765	hsa-miR-31-5p	PAR-CLIP	20371350
MIRT099058	hsa-miR-6809-5p	PAR-CLIP	20371350
MIRT316768	hsa-miR-3175	PAR-CLIP	20371350
MIRT099054	hsa-miR-5095	PAR-CLIP	20371350
MIRT099060	hsa-miR-7151-3p	PAR-CLIP	20371350
MIRT006344	hsa-miR-204-5p	PAR-CLIP	20371350
MIRT099067	hsa-miR-211-5p	PAR-CLIP	20371350
MIRT316775	hsa-miR-548e-5p	PAR-CLIP	20371350
MIRT316778	hsa-miR-6835-3p	PAR-CLIP	20371350
MIRT316777	hsa-miR-548at-5p	PAR-CLIP	20371350
MIRT316774	hsa-miR-561-3p	PAR-CLIP	20371350
MIRT316776	hsa-miR-4742-5p	PAR-CLIP	20371350
MIRT567522	hsa-miR-4269	PAR-CLIP	20371350
MIRT567521	hsa-miR-6715b-5p	PAR-CLIP	20371350
MIRT567520	hsa-miR-4514	PAR-CLIP	20371350
MIRT567519	hsa-miR-4692	PAR-CLIP	20371350
MIRT099075	hsa-miR-6832-3p	PAR-CLIP	20371350
MIRT567518	hsa-miR-1292-5p	PAR-CLIP	20371350
MIRT567517	hsa-miR-4471	PAR-CLIP	20371350
MIRT567516	hsa-miR-8059	PAR-CLIP	20371350
MIRT260591	hsa-miR-374a-5p	PAR-CLIP	20371350
MIRT260596	hsa-miR-374b-5p	PAR-CLIP	20371350
MIRT099069	hsa-miR-623	PAR-CLIP	20371350
MIRT099073	hsa-miR-4755-5p	PAR-CLIP	20371350
MIRT099074	hsa-miR-5006-3p	PAR-CLIP	20371350
MIRT099063	hsa-miR-450a-1-3p	PAR-CLIP	20371350
MIRT567515	hsa-miR-3122	PAR-CLIP	20371350
MIRT567514	hsa-miR-3913-5p	PAR-CLIP	20371350
MIRT567513	hsa-miR-887-5p	PAR-CLIP	20371350
MIRT567512	hsa-miR-6513-5p	PAR-CLIP	20371350
MIRT099072	hsa-miR-4446-5p	PAR-CLIP	20371350
MIRT567511	hsa-miR-495-3p	PAR-CLIP	20371350
MIRT567510	hsa-miR-5688	PAR-CLIP	20371350
MIRT316786	hsa-miR-32-3p	PAR-CLIP	20371350
MIRT567509	hsa-miR-6758-3p	PAR-CLIP	20371350
MIRT316788	hsa-miR-4790-3p	PAR-CLIP	20371350
MIRT316787	hsa-miR-4477a	PAR-CLIP	20371350
MIRT567508	hsa-miR-6715b-3p	PAR-CLIP	20371350
MIRT557834	hsa-miR-6895-5p	PAR-CLIP	20371350
MIRT099065	hsa-miR-4464	PAR-CLIP	20371350
MIRT099066	hsa-miR-4748	PAR-CLIP	20371350
MIRT099064	hsa-miR-329-5p	PAR-CLIP	20371350
MIRT099112	hsa-miR-3607-3p	PAR-CLIP	20371350
MIRT099110	hsa-miR-219a-5p	PAR-CLIP	20371350
MIRT099114	hsa-miR-4782-3p	PAR-CLIP	20371350
MIRT099115	hsa-miR-6766-3p	PAR-CLIP	20371350
MIRT557833	hsa-miR-4433b-5p	PAR-CLIP	20371350
MIRT099113	hsa-miR-4646-3p	PAR-CLIP	20371350
MIRT557834	hsa-miR-6895-5p	PAR-CLIP	20371350
MIRT099065	hsa-miR-4464	PAR-CLIP	20371350
MIRT099066	hsa-miR-4748	PAR-CLIP	20371350
MIRT099064	hsa-miR-329-5p	PAR-CLIP	20371350
MIRT099110	hsa-miR-219a-5p	PAR-CLIP	20371350
MIRT099114	hsa-miR-4782-3p	PAR-CLIP	20371350
MIRT099115	hsa-miR-6766-3p	PAR-CLIP	20371350
MIRT557833	hsa-miR-4433b-5p	PAR-CLIP	20371350
MIRT099113	hsa-miR-4646-3p	PAR-CLIP	20371350
MIRT557834	hsa-miR-6895-5p	PAR-CLIP	21572407
MIRT099065	hsa-miR-4464	PAR-CLIP	21572407
MIRT099066	hsa-miR-4748	PAR-CLIP	21572407
MIRT099064	hsa-miR-329-5p	PAR-CLIP	21572407
MIRT099112	hsa-miR-3607-3p	PAR-CLIP	21572407
MIRT099110	hsa-miR-219a-5p	PAR-CLIP	21572407
MIRT099114	hsa-miR-4782-3p	PAR-CLIP	21572407
MIRT099115	hsa-miR-6766-3p	PAR-CLIP	21572407
MIRT557833	hsa-miR-4433b-5p	PAR-CLIP	21572407
MIRT099113	hsa-miR-4646-3p	PAR-CLIP	21572407
MIRT257295	hsa-miR-3609	PAR-CLIP	21572407
MIRT257297	hsa-miR-548ah-5p	PAR-CLIP	21572407
MIRT257281	hsa-miR-106a-5p	PAR-CLIP	21572407
MIRT257283	hsa-miR-106b-5p	PAR-CLIP	21572407
MIRT257278	hsa-miR-17-5p	PAR-CLIP	21572407
MIRT257279	hsa-miR-20a-5p	PAR-CLIP	21572407
MIRT257287	hsa-miR-20b-5p	PAR-CLIP	21572407
MIRT257289	hsa-miR-519d-3p	PAR-CLIP	21572407
MIRT257288	hsa-miR-526b-3p	PAR-CLIP	21572407
MIRT257280	hsa-miR-93-5p	PAR-CLIP	21572407
MIRT257298	hsa-miR-4796-3p	PAR-CLIP	21572407
MIRT257290	hsa-miR-500a-5p	PAR-CLIP	21572407
MIRT257291	hsa-miR-501-5p	PAR-CLIP	21572407
MIRT257285	hsa-miR-302b-5p	PAR-CLIP	21572407
MIRT257286	hsa-miR-302d-5p	PAR-CLIP	21572407
MIRT548182	hsa-miR-4513	PAR-CLIP	21572407
MIRT548183	hsa-miR-6855-3p	PAR-CLIP	21572407
MIRT548181	hsa-miR-6857-3p	PAR-CLIP	21572407
MIRT540052	hsa-miR-103a-3p	PAR-CLIP	21572407
MIRT540051	hsa-miR-107	PAR-CLIP	21572407
MIRT257282	hsa-miR-223-5p	PAR-CLIP	21572407
MIRT548180	hsa-miR-3136-5p	PAR-CLIP	21572407
MIRT548178	hsa-miR-4439	PAR-CLIP	21572407
MIRT548179	hsa-miR-943	PAR-CLIP	21572407
MIRT540050	hsa-miR-7156-3p	PAR-CLIP	21572407
MIRT540049	hsa-miR-1301-3p	PAR-CLIP	21572407
MIRT540048	hsa-miR-5047	PAR-CLIP	21572407
MIRT540047	hsa-miR-302c-5p	PAR-CLIP	21572407
MIRT540046	hsa-miR-6516-5p	PAR-CLIP	21572407
MIRT257295	hsa-miR-3609	PAR-CLIP	21572407
MIRT257297	hsa-miR-548ah-5p	PAR-CLIP	21572407
MIRT257281	hsa-miR-106a-5p	PAR-CLIP	21572407
MIRT257283	hsa-miR-106b-5p	PAR-CLIP	21572407
MIRT257278	hsa-miR-17-5p	PAR-CLIP	21572407
MIRT257279	hsa-miR-20a-5p	PAR-CLIP	21572407
MIRT257287	hsa-miR-20b-5p	PAR-CLIP	21572407
MIRT257289	hsa-miR-519d-3p	PAR-CLIP	21572407
MIRT257288	hsa-miR-526b-3p	PAR-CLIP	21572407
MIRT257280	hsa-miR-93-5p	PAR-CLIP	21572407
MIRT257298	hsa-miR-4796-3p	PAR-CLIP	21572407
MIRT548182	hsa-miR-4513	PAR-CLIP	21572407
MIRT548183	hsa-miR-6855-3p	PAR-CLIP	21572407
MIRT548181	hsa-miR-6857-3p	PAR-CLIP	21572407
MIRT540052	hsa-miR-103a-3p	PAR-CLIP	21572407
MIRT540051	hsa-miR-107	PAR-CLIP	21572407
MIRT257282	hsa-miR-223-5p	PAR-CLIP	21572407
MIRT548180	hsa-miR-3136-5p	PAR-CLIP	21572407
MIRT548178	hsa-miR-4439	PAR-CLIP	21572407
MIRT548179	hsa-miR-943	PAR-CLIP	21572407
MIRT540050	hsa-miR-7156-3p	PAR-CLIP	21572407
MIRT540049	hsa-miR-1301-3p	PAR-CLIP	21572407
MIRT540048	hsa-miR-5047	PAR-CLIP	21572407
MIRT540046	hsa-miR-6516-5p	PAR-CLIP	21572407
MIRT257295	hsa-miR-3609	PAR-CLIP	21572407
MIRT257297	hsa-miR-548ah-5p	PAR-CLIP	21572407
MIRT257281	hsa-miR-106a-5p	PAR-CLIP	21572407
MIRT257283	hsa-miR-106b-5p	PAR-CLIP	21572407
MIRT257278	hsa-miR-17-5p	PAR-CLIP	21572407
MIRT257279	hsa-miR-20a-5p	PAR-CLIP	21572407
MIRT257287	hsa-miR-20b-5p	PAR-CLIP	21572407
MIRT257289	hsa-miR-519d-3p	PAR-CLIP	21572407
MIRT257288	hsa-miR-526b-3p	PAR-CLIP	21572407
MIRT257280	hsa-miR-93-5p	PAR-CLIP	21572407
MIRT257298	hsa-miR-4796-3p	PAR-CLIP	21572407
MIRT257290	hsa-miR-500a-5p	PAR-CLIP	21572407
MIRT257291	hsa-miR-501-5p	PAR-CLIP	21572407
MIRT257285	hsa-miR-302b-5p	PAR-CLIP	21572407
MIRT257286	hsa-miR-302d-5p	PAR-CLIP	21572407
MIRT540052	hsa-miR-103a-3p	PAR-CLIP	21572407
MIRT540051	hsa-miR-107	PAR-CLIP	21572407
MIRT257282	hsa-miR-223-5p	PAR-CLIP	21572407
MIRT540050	hsa-miR-7156-3p	PAR-CLIP	21572407
MIRT540049	hsa-miR-1301-3p	PAR-CLIP	21572407
MIRT540048	hsa-miR-5047	PAR-CLIP	21572407
MIRT540047	hsa-miR-302c-5p	PAR-CLIP	21572407
MIRT540046	hsa-miR-6516-5p	PAR-CLIP	21572407
MIRT454702	hsa-miR-483-5p	PAR-CLIP	23592263
MIRT316771	hsa-miR-6758-5p	PAR-CLIP	23592263
MIRT316772	hsa-miR-6856-5p	PAR-CLIP	23592263
MIRT483142	hsa-miR-4779	PAR-CLIP	23592263
MIRT483141	hsa-miR-6783-5p	PAR-CLIP	23592263
MIRT454701	hsa-miR-139-3p	PAR-CLIP	23592263
MIRT483140	hsa-miR-765	PAR-CLIP	23592263
MIRT483139	hsa-miR-3153	PAR-CLIP	23592263
MIRT483138	hsa-miR-6733-5p	PAR-CLIP	23592263
MIRT483137	hsa-miR-6739-5p	PAR-CLIP	23592263
MIRT483136	hsa-miR-7106-5p	PAR-CLIP	23592263
MIRT316768	hsa-miR-3175	PAR-CLIP	23592263
MIRT099050	hsa-miR-552-3p	PAR-CLIP	23592263
MIRT454702	hsa-miR-483-5p	PAR-CLIP	23592263
MIRT316771	hsa-miR-6758-5p	PAR-CLIP	23592263
MIRT316772	hsa-miR-6856-5p	PAR-CLIP	23592263
MIRT483142	hsa-miR-4779	PAR-CLIP	23592263
MIRT483141	hsa-miR-6783-5p	PAR-CLIP	23592263
MIRT099048	hsa-miR-200a-5p	PAR-CLIP	23592263
MIRT099046	hsa-miR-200b-5p	PAR-CLIP	23592263
MIRT099059	hsa-miR-6830-5p	PAR-CLIP	23592263
MIRT099047	hsa-miR-125a-3p	PAR-CLIP	23592263
MIRT099051	hsa-miR-600	PAR-CLIP	23592263
MIRT316769	hsa-miR-3185	PAR-CLIP	23592263
MIRT316766	hsa-miR-605-3p	PAR-CLIP	23592263
MIRT454701	hsa-miR-139-3p	PAR-CLIP	23592263
MIRT483140	hsa-miR-765	PAR-CLIP	23592263
MIRT316765	hsa-miR-31-5p	PAR-CLIP	23592263
MIRT099058	hsa-miR-6809-5p	PAR-CLIP	23592263
MIRT483139	hsa-miR-3153	PAR-CLIP	23592263
MIRT483138	hsa-miR-6733-5p	PAR-CLIP	23592263
MIRT483137	hsa-miR-6739-5p	PAR-CLIP	23592263
MIRT483136	hsa-miR-7106-5p	PAR-CLIP	23592263
MIRT316768	hsa-miR-3175	PAR-CLIP	23592263
MIRT099054	hsa-miR-5095	PAR-CLIP	23592263
MIRT099060	hsa-miR-7151-3p	PAR-CLIP	23592263
MIRT099050	hsa-miR-552-3p	PAR-CLIP	23592263
MIRT454702	hsa-miR-483-5p	PAR-CLIP	23592263
MIRT316771	hsa-miR-6758-5p	PAR-CLIP	23592263
MIRT316772	hsa-miR-6856-5p	PAR-CLIP	23592263
MIRT099048	hsa-miR-200a-5p	PAR-CLIP	23592263
MIRT099046	hsa-miR-200b-5p	PAR-CLIP	23592263
MIRT099059	hsa-miR-6830-5p	PAR-CLIP	23592263
MIRT099047	hsa-miR-125a-3p	PAR-CLIP	23592263
MIRT099051	hsa-miR-600	PAR-CLIP	23592263
MIRT316769	hsa-miR-3185	PAR-CLIP	23592263
MIRT316766	hsa-miR-605-3p	PAR-CLIP	23592263
MIRT454701	hsa-miR-139-3p	PAR-CLIP	23592263
MIRT316765	hsa-miR-31-5p	PAR-CLIP	23592263
MIRT099058	hsa-miR-6809-5p	PAR-CLIP	23592263
MIRT316768	hsa-miR-3175	PAR-CLIP	23592263
MIRT099054	hsa-miR-5095	PAR-CLIP	23592263
MIRT099060	hsa-miR-7151-3p	PAR-CLIP	23592263
MIRT755345	hsa-miR-149-5p	Luciferase reporter assay, qRT-PCR	34957298
MIRT1001484	hsa-miR-106a	CLIP-seq
MIRT1001485	hsa-miR-106b	CLIP-seq
MIRT1001486	hsa-miR-1266	CLIP-seq
MIRT1001487	hsa-miR-1283	CLIP-seq
MIRT1001488	hsa-miR-1292	CLIP-seq
MIRT1001489	hsa-miR-133a	CLIP-seq
MIRT1001490	hsa-miR-138	CLIP-seq
MIRT1001491	hsa-miR-141	CLIP-seq
MIRT1001492	hsa-miR-17	CLIP-seq
MIRT1001493	hsa-miR-200a	CLIP-seq
MIRT1001494	hsa-miR-20a	CLIP-seq
MIRT1001495	hsa-miR-20b	CLIP-seq
MIRT1001496	hsa-miR-2276	CLIP-seq
MIRT1001497	hsa-miR-28-5p	CLIP-seq
MIRT1001498	hsa-miR-3074-5p	CLIP-seq
MIRT1001499	hsa-miR-3120-3p	CLIP-seq
MIRT1001500	hsa-miR-3121-3p	CLIP-seq
MIRT1001501	hsa-miR-3126-3p	CLIP-seq
MIRT1001502	hsa-miR-3139	CLIP-seq
MIRT1001503	hsa-miR-3152-5p	CLIP-seq
MIRT1001504	hsa-miR-3160-3p	CLIP-seq
MIRT1001505	hsa-miR-3170	CLIP-seq
MIRT1001506	hsa-miR-3610	CLIP-seq
MIRT1001507	hsa-miR-3650	CLIP-seq
MIRT1001508	hsa-miR-3653	CLIP-seq
MIRT1001509	hsa-miR-3658	CLIP-seq
MIRT1001510	hsa-miR-3664-3p	CLIP-seq
MIRT1001511	hsa-miR-370	CLIP-seq
MIRT1001512	hsa-miR-3907	CLIP-seq
MIRT1001513	hsa-miR-3943	CLIP-seq
MIRT1001514	hsa-miR-4255	CLIP-seq
MIRT1001515	hsa-miR-4260	CLIP-seq
MIRT1001516	hsa-miR-4275	CLIP-seq
MIRT1001517	hsa-miR-4299	CLIP-seq
MIRT1001518	hsa-miR-4312	CLIP-seq
MIRT1001519	hsa-miR-4423-5p	CLIP-seq
MIRT1001520	hsa-miR-4427	CLIP-seq
MIRT1001521	hsa-miR-4434	CLIP-seq
MIRT1001522	hsa-miR-4443	CLIP-seq
MIRT1001523	hsa-miR-4487	CLIP-seq
MIRT1001524	hsa-miR-4516	CLIP-seq
MIRT1001525	hsa-miR-4518	CLIP-seq
MIRT1001526	hsa-miR-4531	CLIP-seq
MIRT1001527	hsa-miR-4652-3p	CLIP-seq
MIRT1001528	hsa-miR-4659a-3p	CLIP-seq
MIRT1001529	hsa-miR-4659b-3p	CLIP-seq
MIRT1001530	hsa-miR-4680-3p	CLIP-seq
MIRT1001531	hsa-miR-4710	CLIP-seq
MIRT1001532	hsa-miR-4720-3p	CLIP-seq
MIRT1001533	hsa-miR-4742-3p	CLIP-seq
MIRT1001534	hsa-miR-4774-3p	CLIP-seq
MIRT1001535	hsa-miR-4777-5p	CLIP-seq
MIRT1001536	hsa-miR-4778-5p	CLIP-seq
MIRT1001537	hsa-miR-4804-3p	CLIP-seq
MIRT1001538	hsa-miR-516b	CLIP-seq
MIRT1001539	hsa-miR-517a	CLIP-seq
MIRT1001540	hsa-miR-517c	CLIP-seq
MIRT1001541	hsa-miR-519d	CLIP-seq
MIRT1001542	hsa-miR-548ah	CLIP-seq
MIRT1001543	hsa-miR-548q	CLIP-seq
MIRT1001544	hsa-miR-549	CLIP-seq
MIRT1001545	hsa-miR-558	CLIP-seq
MIRT1001546	hsa-miR-561	CLIP-seq
MIRT1001547	hsa-miR-593	CLIP-seq
MIRT1001548	hsa-miR-595	CLIP-seq
MIRT1001549	hsa-miR-626	CLIP-seq
MIRT1001550	hsa-miR-708	CLIP-seq
MIRT1001551	hsa-miR-760	CLIP-seq
MIRT1001552	hsa-miR-802	CLIP-seq
MIRT1001553	hsa-miR-93	CLIP-seq
MIRT1001486	hsa-miR-1266	CLIP-seq
MIRT1001487	hsa-miR-1283	CLIP-seq
MIRT1996773	hsa-miR-1290	CLIP-seq
MIRT1001488	hsa-miR-1292	CLIP-seq
MIRT1001489	hsa-miR-133a	CLIP-seq
MIRT1001490	hsa-miR-138	CLIP-seq
MIRT1996774	hsa-miR-204	CLIP-seq
MIRT1996775	hsa-miR-211	CLIP-seq
MIRT1001498	hsa-miR-3074-5p	CLIP-seq
MIRT1001504	hsa-miR-3160-3p	CLIP-seq
MIRT1996776	hsa-miR-3167	CLIP-seq
MIRT1996777	hsa-miR-3174	CLIP-seq
MIRT1996778	hsa-miR-3606	CLIP-seq
MIRT1001512	hsa-miR-3907	CLIP-seq
MIRT1001517	hsa-miR-4299	CLIP-seq
MIRT1001523	hsa-miR-4487	CLIP-seq
MIRT1001525	hsa-miR-4518	CLIP-seq
MIRT1001528	hsa-miR-4659a-3p	CLIP-seq
MIRT1001529	hsa-miR-4659b-3p	CLIP-seq
MIRT1001530	hsa-miR-4680-3p	CLIP-seq
MIRT1001531	hsa-miR-4710	CLIP-seq
MIRT1001539	hsa-miR-517a	CLIP-seq
MIRT1001540	hsa-miR-517c	CLIP-seq
MIRT1996779	hsa-miR-539	CLIP-seq
MIRT1001543	hsa-miR-548q	CLIP-seq
MIRT1001545	hsa-miR-558	CLIP-seq
MIRT1996780	hsa-miR-616	CLIP-seq
MIRT1996781	hsa-miR-876-5p	CLIP-seq
MIRT1996782	hsa-miR-921	CLIP-seq
MIRT2230731	hsa-miR-371-5p	CLIP-seq
MIRT2230732	hsa-miR-371b-5p	CLIP-seq
MIRT2230733	hsa-miR-513c	CLIP-seq
MIRT2230734	hsa-miR-514b-5p	CLIP-seq
MIRT2681099	hsa-miR-3163	CLIP-seq
MIRT1001533	hsa-miR-4742-3p	CLIP-seq
MIRT2681100	hsa-miR-568	CLIP-seq
MIRT1001547	hsa-miR-593	CLIP-seq
MIRT1001549	hsa-miR-626	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
BRCA1	Repression	22120723
EZH2	Repression	21465172
GATA3	Repression	22120723

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	ISS
GO:0000785	Component	Chromatin	ISA
GO:0000792	Component	Heterochromatin	IDA	15684392
GO:0000976	Function	Transcription cis-regulatory region binding	IDA	17210863, 19279310, 25786029, 27804176
GO:0000976	Function	Transcription cis-regulatory region binding	IEA
GO:0000976	Function	Transcription cis-regulatory region binding	ISS
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IDA	7957066
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IDA	17993506
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IEA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	ISS
GO:0001501	Process	Skeletal system development	IEA
GO:0001503	Process	Ossification	IEA
GO:0001525	Process	Angiogenesis	IEA
GO:0001541	Process	Ovarian follicle development	IEA
GO:0001568	Process	Blood vessel development	IEA
GO:0001654	Process	Eye development	IDA	9792859
GO:0001654	Process	Eye development	IEA
GO:0001657	Process	Ureteric bud development	IEA
GO:0001657	Process	Ureteric bud development	ISS
GO:0001701	Process	In utero embryonic development	IEA
GO:0001756	Process	Somitogenesis	IEA
GO:0001822	Process	Kidney development	IEA
GO:0001822	Process	Kidney development	ISS
GO:0001945	Process	Lymph vessel development	IEA
GO:0001958	Process	Endochondral ossification	IEA
GO:0001958	Process	Endochondral ossification	ISS
GO:0001974	Process	Blood vessel remodeling	IEA
GO:0003007	Process	Heart morphogenesis	IEA
GO:0003275	Process	Apoptotic process involved in outflow tract morphogenesis	IEA
GO:0003677	Function	DNA binding	IDA	7957066, 11179011, 15684392
GO:0003677	Function	DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IDA	11179011, 11782474, 14506133, 14578375, 15277473, 15299087, 15684392, 27804176
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IMP	14578375, 16449236, 17210863, 19279310, 19793056, 25786029
GO:0005515	Function	Protein binding	IPI	15684392, 16449236, 18676636, 22190034, 25609649, 26565916
GO:0005634	Component	Nucleus	IC	7957066
GO:0005634	Component	Nucleus	IDA	11179011, 11562355, 11782474, 14506133, 14578375, 15277473, 15299087, 16449236, 17210863, 19279310, 19793056, 20406990, 25786029, 26565916, 27804176
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005829	Component	Cytosol	IDA
GO:0006355	Process	Regulation of DNA-templated transcription	IDA	11782474, 14506133, 15299087, 15684392
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0007219	Process	Notch signaling pathway	IEA
GO:0007420	Process	Brain development	IEA
GO:0007507	Process	Heart development	IDA	10474162
GO:0007507	Process	Heart development	IEA
GO:0008283	Process	Cell population proliferation	IDA	20406990
GO:0008283	Process	Cell population proliferation	IMP	22991501
GO:0008301	Function	DNA binding, bending	IDA	7957066, 14506133
GO:0008354	Process	Germ cell migration	IEA
GO:0009653	Process	Anatomical structure morphogenesis	IBA
GO:0010628	Process	Positive regulation of gene expression	IEA
GO:0010718	Process	Positive regulation of epithelial to mesenchymal transition	IMP	22991501
GO:0014031	Process	Mesenchymal cell development	IEA
GO:0014031	Process	Mesenchymal cell development	ISS
GO:0014032	Process	Neural crest cell development	IEA
GO:0016477	Process	Cell migration	IDA	20406990
GO:0016477	Process	Cell migration	IMP	22991501
GO:0016525	Process	Negative regulation of angiogenesis	IEA
GO:0016525	Process	Negative regulation of angiogenesis	ISS
GO:0021549	Process	Cerebellum development	IEA
GO:0021549	Process	Cerebellum development	ISS
GO:0030154	Process	Cell differentiation	IBA
GO:0030199	Process	Collagen fibril organization	IEA
GO:0030203	Process	Glycosaminoglycan metabolic process	IEA
GO:0032808	Process	Lacrimal gland development	IEA
GO:0035050	Process	Embryonic heart tube development	IEA
GO:0036438	Process	Maintenance of lens transparency	IEA
GO:0036438	Process	Maintenance of lens transparency	ISS
GO:0038084	Process	Vascular endothelial growth factor signaling pathway	IEA
GO:0038084	Process	Vascular endothelial growth factor signaling pathway	ISS
GO:0042475	Process	Odontogenesis of dentin-containing tooth	IMP	12614756
GO:0043010	Process	Camera-type eye development	IEA
GO:0043388	Process	Positive regulation of DNA binding	IMP	26565916
GO:0043565	Function	Sequence-specific DNA binding	IDA	7957066, 15277473
GO:0043565	Function	Sequence-specific DNA binding	IEA
GO:0045618	Process	Positive regulation of keratinocyte differentiation	IMP	27907090
GO:0045893	Process	Positive regulation of DNA-templated transcription	IDA	11237714
GO:0045893	Process	Positive regulation of DNA-templated transcription	IDA	15277473
GO:0045893	Process	Positive regulation of DNA-templated transcription	NAS	8499623
GO:0045930	Process	Negative regulation of mitotic cell cycle	IDA	12408963
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	16449236, 17993506
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IMP	14578375, 16492674, 17210863, 19279310, 19793056, 25786029, 27804176, 27907090
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	ISS
GO:0046620	Process	Regulation of organ growth	IEA
GO:0048010	Process	Vascular endothelial growth factor receptor signaling pathway	IEA
GO:0048341	Process	Paraxial mesoderm formation	IEA
GO:0048762	Process	Mesenchymal cell differentiation	IEA
GO:0048844	Process	Artery morphogenesis	IEA
GO:0055010	Process	Ventricular cardiac muscle tissue morphogenesis	IEA
GO:0060038	Process	Cardiac muscle cell proliferation	IEA
GO:0061629	Function	RNA polymerase II-specific DNA-binding transcription factor binding	IPI	16449236
GO:0070098	Process	Chemokine-mediated signaling pathway	IEA
GO:0070098	Process	Chemokine-mediated signaling pathway	ISS
GO:0071364	Process	Cellular response to epidermal growth factor stimulus	IMP	16492674
GO:0072010	Process	Glomerular epithelium development	IEA
GO:0072010	Process	Glomerular epithelium development	ISS
GO:0097746	Process	Blood vessel diameter maintenance	IEA
GO:0140297	Function	DNA-binding transcription factor binding	IPI	15684392
GO:1901491	Process	Negative regulation of lymphangiogenesis	IEA
GO:1901491	Process	Negative regulation of lymphangiogenesis	ISS
GO:1901534	Process	Positive regulation of hematopoietic progenitor cell differentiation	IEA
GO:1901534	Process	Positive regulation of hematopoietic progenitor cell differentiation	ISS
GO:1902038	Process	Positive regulation of hematopoietic stem cell differentiation	IEA
GO:1902038	Process	Positive regulation of hematopoietic stem cell differentiation	ISS
GO:1902257	Process	Negative regulation of apoptotic process involved in outflow tract morphogenesis	IEA
GO:1904798	Process	Positive regulation of core promoter binding	ISS
GO:1990841	Function	Promoter-specific chromatin binding	IEA
GO:1990841	Function	Promoter-specific chromatin binding	ISS
GO:1990869	Process	Cellular response to chemokine	IEA
GO:1990869	Process	Cellular response to chemokine	ISS

Other IDs

• MIM: 601090
• HGNC: 3800
• e!Ensembl: ENSG00000054598

Protein

• UniProt ID: Q12948
• Protein name: Forkhead box protein C1 (Forkhead-related protein FKHL7) (Forkhead-related transcription factor 3) (FREAC-3)
• Protein function: DNA-binding transcriptional factor that plays a role in a broad range of cellular and developmental processes such as eye, bones, cardiovascular, kidney and skin development (PubMed:11782474, PubMed:14506133, PubMed:14578375, PubMed:15277473, Pu
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00250	Forkhead	77 → 163	Forkhead domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed in keratinocytes of epidermis and hair follicle (PubMed:27907090). Expressed strongly in microvascular invasion (MVI) formation, basal-like breast cancer (BLBC) and hepatocellular tumors (PubMed:20406990, PubMed:22991501). Ex
• Sequence:

  MQARYSVSSPNSLGVVPYLGGEQSYYRAAAAAAGGGYTAMPAPMSVYSHPAHAEQYPGGM
  ARAYGPYTPQPQPKDMVKPPYSYIALITMAIQNAPDKKITLNGIYQFIMDRFPFYRDNKQ
  GWQNSIRHNLSLNECFVKVPRDDKKPGKGSYWTLDPDSYNMFENGSFLRRRRRFKKKDAV
  KDKEEKDRLHLKEPPPPGRQPPPAPPEQADGNAPGPQPPPVRIQDIKTENGTCPSPPQPL
  SPAAALGSGSAAAVPKIESPDSSSSSLSSGSSPPGSLPSARPLSLDGADSAPPPPAPSAP
  PPHHSQGFSVDNIMTSLRGSPQSAAAELSSGLLASAAASSRAGIAPPLALGAYSPGQSSL
  YSSPCSQTSSAGSSGGGGGGAGAAGGAGGAGTYHCNLQAMSLYAAGERGGHLQGAPGGAG
  GSAVDDPLPDYSLPPVTSSSSSSLSHGGGGGGGGGGQEAGHHPAAHQGRLTSWYLNQAGG
  DLGHLASAAAAAAAAGYPGQQQNFHSVREMFESQRIGLNNSPVNGNSSCQMAFPSSQSLY
  RTSGAFVYDCSKF

• Sequence length: 553

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Anterior segment dysgenesis	Likely pathogenic; Pathogenic	rs1183655796, rs1762526126, rs1762526692, rs1297907614	RCV001200025 RCV001200042 RCV001200026 RCV001200031	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Anterior segment dysgenesis 3	Likely pathogenic; Pathogenic	rs372857241, rs2113111766, rs2113111662, rs2480505189, rs2113111009, rs104893957, rs104893958, rs104893954, rs2480502500, rs1554100945, rs1057519477, rs1057519480, rs1554100953, rs1762550387	RCV005031595 RCV001808295 RCV002249992 RCV004796723 RCV000008967 RCV000008968 RCV000008969 RCV000008979 RCV005036769 RCV004556158 RCV002272227 RCV004594054 RCV000585805 RCV001281365	★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Axenfeld-Rieger anomaly with partially absent eye muscles, distinctive face, hydrocephaly, and skeletal abnormalities	Pathogenic; Likely pathogenic	rs2471744858, rs2480505189	RCV002291339 RCV002291341	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Axenfeld-Rieger syndrome type 3	Pathogenic; Likely pathogenic	rs1762549789, rs2113110720, rs2113110795, rs2113111289, rs2113112422, rs372857241, rs1183655796, rs376405759, rs2113111355, rs562467758, rs2113112720, rs2113111322, rs1408057194, rs867581817, rs2113111101, rs2480501321, rs2480501881, rs2480502130, rs2480502393, rs2480502418, rs2480502820, rs2480504308, rs2480504901, rs2480506120, rs2480507296, rs2480507628, rs2480502065, rs2480502104, rs1057519474, rs2480502524, rs2480502731, rs2113110837, rs2480505189, rs2480504690, rs2480501985, rs2480501511, rs2480502742, rs1344439858, rs2480501865, rs2480504935, rs2480501614, rs2480504227, rs2480501835, rs104893957, rs104893951, rs104893952, rs104893953, rs121909339, rs886039568, rs2480501382, rs201891353, rs2480505369, rs2480502500, rs2480505650, rs527271139, rs2480506067, rs2480504244, rs2480501444, rs1762550387, rs2480502767, rs2480505702, rs2480502469, rs2480505086, rs1057519471, rs1057519472, rs1057519475, rs1057519478, rs1057519479, rs1057519480, rs1057519481, rs1057519482, rs760676014, rs1085307884, rs368260972, rs1554101000, rs1554100963, rs1241813534, rs1554101058, rs1581373890, rs1581373773, rs1762521548, rs1762522833, rs2230096, rs1762525473, rs1762536800, rs886041355, rs1297907614, rs1762534894	RCV002293582 RCV001383808 RCV001386059 RCV001384841 RCV001390991 RCV000700281 RCV001843374 RCV001650517 RCV001966069 RCV002006657 RCV002002561 RCV002031799 RCV001956299 RCV002250999 RCV002251078 RCV002293572 RCV002293573 RCV002293574 RCV002293575 RCV002293576 RCV002293577 RCV002293578 RCV002293579 RCV002293580 RCV002293583 RCV002293584 RCV002293585 RCV002293586 RCV002293587 RCV002293588 RCV002293589 RCV002293590 RCV002272605 RCV004796723 RCV002828308 RCV002810606 RCV002835257 RCV002816555 RCV002846278 RCV002870799 RCV002861448 RCV002863239 RCV002867568 RCV002923450 RCV003509480 RCV000008971 RCV000008973 RCV000008978 RCV000008981 RCV002293431 RCV000416497 RCV003332930 RCV003389575 RCV003389576 RCV005036769 RCV003510630 RCV003510480 RCV003510778 RCV003510032 RCV003510026 RCV003621066 RCV003621187 RCV003621350 RCV003621451 RCV004556155 RCV000416515 RCV000416537 RCV000416495 RCV000416505 RCV000416521 RCV000416550 RCV000416504 RCV000416528 RCV000416548 RCV000532837 RCV000495841 RCV003619688 RCV000585863 RCV000646226 RCV000646228 RCV000646224 RCV000691768 RCV000817211 RCV000824988 RCV001067954 RCV001064648 RCV001063142 RCV001049764 RCV001062756 RCV001171547 RCV001198073 RCV001859212 RCV001213979 RCV001281365	★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Congenital anomaly of kidney and urinary tract	Likely pathogenic	rs1762519001, rs780038931, rs1581374640	RCV001849728 RCV001849729 RCV001849736	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
FOXC1-related disorder	Likely pathogenic; Pathogenic	rs2480501508, rs2480502500, rs2480504570, rs1085307884	RCV003419013 RCV003399860 RCV003924310 RCV003411525	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Glaucoma of childhood	Pathogenic	rs1762534303	RCV001250453	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Hypertelorism and tetralogy of fallot	Likely pathogenic; Pathogenic	rs1057519479	RCV001267710	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
Alopecia, androgenetic, 1	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANIRIDIA	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANIRIDIA TYPE 1	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANTERIOR SEGMENT MESENCHYMAL DYSGENESIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATAXIA, SPINOCEREBELLAR	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AXENFELD ANOMALY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AXENFELD-RIEGER SYNDROME	—	Disgenet, Orphanet Disgenet, Orphanet Disgenet, Orphanet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AXENFELD-RIEGER SYNDROME, TYPE 1	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AXENFELD-RIEGER SYNDROME, TYPE 3	—	CTD, Disgenet, HPO CTD, Disgenet, HPO CTD, Disgenet, HPO	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CAKUT	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOVASCULAR DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DANDY-WALKER SYNDROME	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESSENTIAL HYPERTENSION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLAUCOMA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLAUCOMA, OPEN-ANGLE	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IRIDO-CORNEO-TRABECULAR DYSGENESIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IRIDOGONIODYSGENESIS TYPE 1	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IRIDOGONIODYSGENESIS, TYPE 1	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IRIS HYPOPLASIA WITH GLAUCOMA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL INFARCTION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RIEGER ANOMALY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RIEGER SYNDROME	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SPINOCEREBELLAR ATAXIAS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Structural eye disease	Conflicting classifications of pathogenicity	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TETRALOGY OF FALLOT	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	29137406		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	30548656		★☆☆☆☆ Found in Text Mining only
Adult Hodgkin Lymphoma	Hodgkin Lymphoma	BEFREE	25043849		★☆☆☆☆ Found in Text Mining only
AL-RAQAD SYNDROME	AL-Raqad Syndrome	BEFREE	10713890, 17653043, 22569110, 23239455, 23687430, 24556684, 27804176, 28226328, 28575017, 29100920, 30457409, 30684501, 31410177		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	31377428, 37848007	Associate	★☆☆☆☆ Found in Text Mining only
Anaplasia	Anaplasia	BEFREE	25008184		★☆☆☆☆ Found in Text Mining only
Aniridia	Aniridia	BEFREE	18484311, 19279310, 28549150, 30457409		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Aniridia	Aniridia	LHGDN	18484311		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Aniridia	Aniridia	ORPHANET_DG	19279310, 27124303		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Aniridia	Aniridia	Pubtator	21423868, 27124303	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Aniridia	Aniridia	HPO_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Aniridia cerebellar ataxia mental deficiency	Aniridia-cerebellar ataxia-intellectual disability syndrome	Pubtator	27124303	Associate	★☆☆☆☆ Found in Text Mining only
Anophthalmos	Syndromic microphthalmia	BEFREE	19626132		★☆☆☆☆ Found in Text Mining only
ANTERIOR SEGMENT DYSGENESIS 5	Anterior segment dysgenesis	GENOMICS_ENGLAND_DG	19793056		★☆☆☆☆ Found in Text Mining only
ANTERIOR SEGMENT DYSGENESIS 5	Anterior segment dysgenesis	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Anterior segment mesenchymal dysgenesis	Anterior segment mesenchymal dysgenesis	Pubtator	17653043, 22569110, 27463523, 32224865	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Anterior synechiae	Synechiae	HPO_DG			★☆☆☆☆ Found in Text Mining only
Aortic coarctation	Aortic Coarctation	BEFREE	26643481		★☆☆☆☆ Found in Text Mining only
Aortic valve disorder	Aortic Valve Disease	BEFREE	28657660		★☆☆☆☆ Found in Text Mining only
Aortic Valve Insufficiency	Aortic Valve Insufficiency	BEFREE	17993506		★☆☆☆☆ Found in Text Mining only
Aortic Valve Stenosis	Aortic valve stenosis	Pubtator	17653043	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	35946462, 40238799	Associate	★☆☆☆☆ Found in Text Mining only
Ataxia, Spinocerebellar	Spinocerebellar Ataxia	CTD_human_DG	19668217		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atherosclerosis	Atherosclerosis	Pubtator	35842645	Associate	★☆☆☆☆ Found in Text Mining only
ATRIAL SEPTAL DEFECT 1	Atrial Septal Defect	BEFREE	18498376, 20881294, 22569110, 30225942, 30457409, 31341655		★☆☆☆☆ Found in Text Mining only
Atrial Septal Defects	Atrial Septal Defect	BEFREE	10474162, 18498376, 20881294, 22569110, 30225942, 30457409, 31341655		★☆☆☆☆ Found in Text Mining only
Atrial Septal Defects	Atrial Septal Defect	HPO_DG			★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	18498376, 20881294, 22569110, 30225942, 30457409, 31341655		★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	Pubtator	32499604	Associate	★☆☆☆☆ Found in Text Mining only
Axenfeld anomaly (disorder)	Axenfeld anomaly	BEFREE	10474162, 10537763, 12454026, 12592227, 15477465, 22903608, 9620769, 9792859		★☆☆☆☆ Found in Text Mining only
Axenfeld anomaly (disorder)	Axenfeld anomaly	ORPHANET_DG	11170889, 9620769		★☆☆☆☆ Found in Text Mining only
Axenfeld anomaly (disorder)	Axenfeld anomaly	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Axenfeld anomaly (disorder)	Axenfeld anomaly	HPO_DG			★☆☆☆☆ Found in Text Mining only
Axenfeld-Rieger syndrome	Axenfeld anomaly	BEFREE	10713890, 11589884, 11740218, 11821690, 12614756, 14630904, 15477465, 15684392, 16449236, 17210863, 17653043, 18498376, 19279310, 19668217, 21837767, 23239455, 23687430, 24556684, 25808752, 25967385, 27070436, 27463523, 27804176, 28513611, 29847662, 30653210, 30684501, 30764547, 31410177		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Axenfeld-Rieger syndrome	Axenfeld anomaly	ORPHANET_DG	19513095		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Axenfeld-Rieger syndrome	Axenfeld anomaly	Orphanet			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Axenfeld-Rieger Syndrome, Type 1	Axenfeld anomaly	CTD_human_DG	14630904		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AXENFELD-RIEGER SYNDROME, TYPE 3	Axenfeld anomaly	CLINVAR_DG	11170889, 11740218, 11782474, 14506133, 16936096, 18498376, 20881294, 24914578, 25786029, 28513611, 28979898		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AXENFELD-RIEGER SYNDROME, TYPE 3	Axenfeld anomaly	UNIPROT_DG	11170889, 11179011, 11589884, 11740218, 12454026, 12592227, 14506133, 14578375, 15277473, 15477465, 16449236, 16936096, 17210863, 17653043, 19279310, 23239455, 24914578, 25786029, 27804176, 9792859		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AXENFELD-RIEGER SYNDROME, TYPE 3	Axenfeld anomaly	GENOMICS_ENGLAND_DG	12614756, 17210863, 19793056, 23686687		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AXENFELD-RIEGER SYNDROME, TYPE 3	Axenfeld anomaly	CTD_human_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	29328384		★☆☆☆☆ Found in Text Mining only
Brachydactyly	Brachydactyly	BEFREE	28111183		★☆☆☆☆ Found in Text Mining only
Breast Cancer, Familial	Breast Cancer	BEFREE	27708239		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	20056007, 20338046, 20406990, 20713713, 22249250, 22645147, 26062653, 27041579, 28028927, 28288141, 29552326, 29864144		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	20056007, 20713713, 22249250, 22645147, 26565916, 27041579, 27708239, 28629477, 29864144, 33057161, 34784418, 37406289	Associate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	26041837	Stimulate	★☆☆☆☆ Found in Text Mining only
Cakut	Congenital anomalies of kidney and urinary tract	BEFREE	25691411		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cakut	Congenital anomalies of the kidney and urinary tract	Pubtator	32475988	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinogenesis	Carcinogenesis	Pubtator	29328384, 30431099	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	29449899, 31372939		★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal	Ductal carcinoma	Pubtator	20056007	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Embryonal	Embryonal carcinoma	Pubtator	19668217	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	22991501	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	33522955	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Intraductal Noninfiltrating	Intraductal noninfiltrating carcinoma	Pubtator	20056007, 24093668	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	28435457		★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	23242609, 30348604	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	27556922	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	Pubtator	32196466	Associate	★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	Pubtator	32295643	Associate	★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	HPO_DG			★☆☆☆☆ Found in Text Mining only
Cerebellar Ataxia	Cerebellar ataxia	Pubtator	36104591	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral Small Vessel Diseases	Cerebral Microangiopathy	BEFREE	25250569		★☆☆☆☆ Found in Text Mining only
Cerebral Small Vessel Diseases	Cerebral microangiopathy	Pubtator	31719132	Associate	★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	GENOMICS_ENGLAND_DG	23686687		★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	29807004		★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	28386355, 28810526, 29328384		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	28386355, 29328384		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	30428305		★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	37895297	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	29884889, 30171256, 30254467, 31623173, 31650548		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	34106567, 36991484, 37017587	Associate	★☆☆☆☆ Found in Text Mining only
Congenital Abnormalities	Congenital abnormalities	Pubtator	22569110	Associate	★☆☆☆☆ Found in Text Mining only
Congenital chromosomal disease	Congenital Chromosomal Disease	BEFREE	23054247		★☆☆☆☆ Found in Text Mining only
Congenital diaphragmatic hernia	Congenital diaphragmatic hernia	BEFREE	23054247		★☆☆☆☆ Found in Text Mining only
Congenital Dysplasia Of The Hip	Developmental dysplasia of the hip	BEFREE	23239455		★☆☆☆☆ Found in Text Mining only
Congenital ectopic pupil	Congenital anomaly of eye	HPO_DG			★☆☆☆☆ Found in Text Mining only
Congenital Heart Defects	Congenital heart defects	BEFREE	22569110, 23239455, 26643481		★☆☆☆☆ Found in Text Mining only
Congenital heart disease	Congenital Heart Disease	BEFREE	23239455		★☆☆☆☆ Found in Text Mining only
Congenital Hydrocephalus	Congenital Hydrocephalus	BEFREE	10704385		★☆☆☆☆ Found in Text Mining only
Congenital ocular coloboma (disorder)	Congenital ocular coloboma	BEFREE	19626132		★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	16952980		★☆☆☆☆ Found in Text Mining only
Conotruncal cardiac defects	Conotruncal cardiac defect	Pubtator	37406974	Associate	★☆☆☆☆ Found in Text Mining only
Cornea plana	Cornea Plana	BEFREE	17558846		★☆☆☆☆ Found in Text Mining only
Corneal Diseases	Corneal disease	Pubtator	35354164	Associate	★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	31517441		★☆☆☆☆ Found in Text Mining only
Cortical Dysplasia	Cortical Dysplasia	BEFREE	20976766		★☆☆☆☆ Found in Text Mining only
Dandy-Walker Syndrome	Dandy-Walker Syndrome	BEFREE	19668217, 22903608		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dandy-Walker Syndrome	Dandy-Walker Syndrome	CTD_human_DG	19668217		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dandy-Walker Syndrome	Dandy-Walker Syndrome	GENOMICS_ENGLAND_DG	23686687		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dandy-Walker Syndrome, Familial	Dandy-Walker Syndrome	CTD_human_DG	19668217		★☆☆☆☆ Found in Text Mining only
Deafness Congenital Heart Defects and Posterior Embryotoxon	Deafness with congenital heart defects and posterior embryotoxon	Pubtator	17653043	Associate	★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	31837247		★☆☆☆☆ Found in Text Mining only
Dental Enamel Hypoplasia	Dental enamel hypoplasia	Pubtator	35882526	Associate	★☆☆☆☆ Found in Text Mining only
Developmental Disabilities	Development Disorder	BEFREE	24556684, 9635428		★☆☆☆☆ Found in Text Mining only
Developmental Disabilities	Developmental disability	Pubtator	34566401	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	34982020	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	37626284	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	32041280	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	18508967, 25008184, 25085843, 28115289		★☆☆☆☆ Found in Text Mining only
Disorder of eye	Disorder Of Eye	GENOMICS_ENGLAND_DG			★☆☆☆☆ Found in Text Mining only
Double ureter	Double Ureter	BEFREE	10704385		★☆☆☆☆ Found in Text Mining only
Ear Diseases	Ear disease	Pubtator	33231930	Associate	★☆☆☆☆ Found in Text Mining only
ECTRODACTYLY, ECTODERMAL DYSPLASIA, AND CLEFT LIP/PALATE SYNDROME 1	Ectrodactyly	BEFREE	21400511		★☆☆☆☆ Found in Text Mining only
Endocrine System Diseases	Endocrine system disease	Pubtator	27041579	Associate	★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	21400511		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	34948036	Associate	★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	34082653	Stimulate	★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	28861321		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	28861321		★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	25031703, 35882526	Associate	★☆☆☆☆ Found in Text Mining only
Ewings sarcoma	Ewing sarcoma	BEFREE	17425403		★☆☆☆☆ Found in Text Mining only
Exfoliation Syndrome	Exfoliation Syndrome	BEFREE	29550933		★☆☆☆☆ Found in Text Mining only
Exophthalmos	Proptosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Eye Abnormalities	Eye abnormalities	Pubtator	19626132, 22234157, 35882526	Associate	★☆☆☆☆ Found in Text Mining only
Facial Dysmorphism with Multiple Malformations	Facial dysmorphism syndrome	Pubtator	33231930	Associate	★☆☆☆☆ Found in Text Mining only
GATA2 Deficiency	Gata2 deficiency	Pubtator	32632082	Associate	★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	Pubtator	10507730, 11007653, 11170889, 11320352, 15684392, 16492674, 17653043, 19626132, 19668217, 24556684, 25786029, 26220699, 26240509, 27272408, 28513611, 28575017, 30653210, 32832252, 33892047, 35144644, 35354164, 35882526	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glaucoma	Glaucoma	BEFREE	10767326, 11170889, 11880716, 12036988, 15684392, 16638984, 17197537, 17993506, 18676636, 19279310, 19626132, 19668217, 24556684, 25786029, 25967385, 26220699, 27272408, 28513611, 28575017, 29023440, 29751260, 29847662, 30684501, 31836490, 9635428, 9792859		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glaucoma	Glaucoma	LHGDN	18484311, 18708620		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glaucoma	Glaucoma	HPO_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glaucoma 3 Primary Congenital A	Glaucoma	Pubtator	11320352, 21031026, 26220699, 27463523, 28513611, 30653210, 32832252, 39337513	Associate	★☆☆☆☆ Found in Text Mining only
Glaucoma of childhood	Glaucoma	BEFREE	10713890, 11320352, 11740218, 15477465, 16638984, 17653043, 25967385, 30653210		★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Glaucoma of childhood	Glaucoma	HPO_DG			★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Glaucoma Open Angle	Open angle glaucoma	Pubtator	28513611, 32476818, 32832252, 36994723, 37032519	Associate	★☆☆☆☆ Found in Text Mining only
Glaucoma, Open-Angle	Glaucoma	CTD_human_DG	26752265		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glaucoma, Primary Open Angle	Glaucoma	BEFREE	22736943, 26752265		★☆☆☆☆ Found in Text Mining only
Glaucoma, Primary Open Angle	Glaucoma	CTD_human_DG	26752265		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	28287613, 28376685, 30431099		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	28376685	Stimulate	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	30431099	Associate	★☆☆☆☆ Found in Text Mining only
Global developmental delay	Developmental Delay	BEFREE	28657660		★☆☆☆☆ Found in Text Mining only
Growth Disorders	Growth disorder	Pubtator	17653043	Associate	★☆☆☆☆ Found in Text Mining only
Hearing Loss	Hearing loss	Pubtator	17653043, 35882526, 37895297	Associate	★☆☆☆☆ Found in Text Mining only
Hearing Loss Conductive	Conductive hearing loss	Pubtator	34809627	Associate	★☆☆☆☆ Found in Text Mining only
Heart Defects Congenital	Congenital heart defect	Pubtator	22569110, 35882526	Associate	★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	16952980		★☆☆☆☆ Found in Text Mining only
Hematologic Diseases	Hematologic disease	Pubtator	33837967	Associate	★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	11376869, 25043849		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	34807923	Associate	★☆☆☆☆ Found in Text Mining only
Hydrocephalus	Hydrocephalus	Pubtator	37895297	Associate	★☆☆☆☆ Found in Text Mining only
Hydrocephalus	Hydrocephalus	BEFREE	9635428		★☆☆☆☆ Found in Text Mining only
HYDROCEPHALUS, NONSYNDROMIC, AUTOSOMAL RECESSIVE 1	Hydrocephalus	BEFREE	9635428		★☆☆☆☆ Found in Text Mining only
Hydrophthalmos	Glaucoma, congenital	BEFREE	10713890, 11320352, 11740218, 15477465, 16638984, 17653043, 18484311, 19279310, 23378721, 25967385, 26220699, 27463523, 30653210, 30684501		★☆☆☆☆ Found in Text Mining only
Hydrophthalmos	Glaucoma, congenital	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hypersensitivity Delayed	Hypersensitivity	Pubtator	35882526	Associate	★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	28732058		★☆☆☆☆ Found in Text Mining only
Hypodontia	Hypodontia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hypoplasia of iris	Hypoplasia Of Iris	BEFREE	9620769		★☆☆☆☆ Found in Text Mining only
Hypoplasia of iris	Hypoplasia Of Iris	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hypoplasia of the maxilla	Hypoplasia of the maxilla	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hypospadias	Hypospadias	HPO_DG			★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	BEFREE	15578619		★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Intellectual developmental disorder	Pubtator	36104591	Associate	★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral disc disease	Pubtator	36972403	Associate	★☆☆☆☆ Found in Text Mining only
Irido-corneal dysgenesis	Anterior segment dysgenesis	BEFREE	10474162, 12454026, 16449236, 17558846, 18708620, 27463523, 28911203, 30225942, 30457409, 31836490		★☆☆☆☆ Found in Text Mining only
Irido-corneo-trabecular dysgenesis (disorder)	Anterior segment dysgenesis	ORPHANET_DG	11170889, 12614756, 18498376, 9620769		★☆☆☆☆ Found in Text Mining only
Irido-corneo-trabecular dysgenesis (disorder)	Anterior segment dysgenesis	BEFREE	12614756, 18498376		★☆☆☆☆ Found in Text Mining only
Irido-corneo-trabecular dysgenesis (disorder)	Anterior segment dysgenesis	GENOMICS_ENGLAND_DG			★☆☆☆☆ Found in Text Mining only
Irido-corneo-trabecular dysgenesis (disorder)	Anterior segment dysgenesis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Iridogoniodysgenesis dominant type	Iridogoniodysgenesis	Pubtator	10507730	Associate	★☆☆☆☆ Found in Text Mining only
IRIDOGONIODYSGENESIS, TYPE 1 (disorder)	Iridogoniodysgenesis	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
IRIDOGONIODYSGENESIS, TYPE 1 (disorder)	Iridogoniodysgenesis	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
IRIS HYPOPLASIA WITH GLAUCOMA	IRIS HYPOPLASIA WITH GLAUCOMA	BEFREE	11007653		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IRIS HYPOPLASIA WITH GLAUCOMA	IRIS HYPOPLASIA WITH GLAUCOMA	UNIPROT_DG	12614756, 18484311, 19279310, 19793056, 20881294, 9620769		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IRIS HYPOPLASIA WITH GLAUCOMA	IRIS HYPOPLASIA WITH GLAUCOMA	GENOMICS_ENGLAND_DG	12614756, 17210863, 19793056, 23686687		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Keratoconjunctivitis	Keratoconjunctivitis	BEFREE	27216851		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	19626132	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	23567938, 28115289		★☆☆☆☆ Found in Text Mining only
Laryngeal Squamous Cell Carcinoma	Laryngeal Carcinoma	BEFREE	28819440		★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	31633499, 8912525		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	35504885	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	34551306, 35633546	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	15161671, 23660386, 26373280, 28699225, 29137406, 31752577		★☆☆☆☆ Found in Text Mining only
Leukopenia	Leukopenia	BEFREE	28699225		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	22911555, 26065367, 26720420, 29552326, 31512996		★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	26065367		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Discoid	Lupus Erythematosus	BEFREE	3430520		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	3430520		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	23242609, 23264086, 26461269	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphedema distichiasis syndrome	Lymphedema-Distichiasis Syndrome	BEFREE	16081467		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	20056007, 20338046, 20406990, 20713713, 22120723, 22249250, 22645147, 26062653, 26565916, 27041579, 28028927, 28288141, 29552326, 29864144		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	21400511		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	28861321		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gastrointestinal tract	Malignant gastrointestinal tract tumors	BEFREE	15598214		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	26720420		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	28435457		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	25875420, 29976975		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	11155740, 19220249, 21266046		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CTD_human_DG	17199135		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	12408963, 19220249, 22645147, 23242609, 24889262, 25516208, 26461269, 26565916, 28288141, 28912845, 29328384, 29449899, 29487724, 30171256, 30189871, 30564302, 30764547, 31512996, 31623173, 31650548		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	28386355, 29328384		★☆☆☆☆ Found in Text Mining only
Malocclusion	Malocclusion	Pubtator	35882526	Associate	★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	27533251		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	27533251	Associate	★☆☆☆☆ Found in Text Mining only
Mental Retardation	Mental retardation	BEFREE	15578619		★☆☆☆☆ Found in Text Mining only
Microdontia (disorder)	Microdontia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Microvascular Angina	Microvascular angina	Pubtator	22991501	Stimulate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	29751260		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	7672091		★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial Ischemia	BEFREE	31517441		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	26461269, 26585487, 28635400		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	26461269, 28635400	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	12408963, 17425403, 20056007, 20338046, 23242609, 23264086, 23444221, 24093668, 26065367, 26565916, 26585487, 27685901, 27708239, 28288141, 28376685, 28386355, 28435457, 28819440, 30564302, 31512996, 31597217		★☆☆☆☆ Found in Text Mining only
Neutropenia	Neutropenia	BEFREE	28699225		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	23264086, 30189871, 31597217, 31783879		★☆☆☆☆ Found in Text Mining only
Noninfiltrating Intraductal Carcinoma	Ductal carcinoma	BEFREE	20056007		★☆☆☆☆ Found in Text Mining only
Nystagmus	Nystagmus	HPO_DG			★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	29342124		★☆☆☆☆ Found in Text Mining only
Ocular Hypertension	Ocular Hypertension	BEFREE	22736943		★☆☆☆☆ Found in Text Mining only
Oculocerebrorenal Syndrome	Oculocerebrorenal syndrome	Pubtator	33231930	Associate	★☆☆☆☆ Found in Text Mining only
Oestrogen receptor positive breast cancer	Oestrogen Receptor Positive Breast Cancer	BEFREE	28028927		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	28912845		★☆☆☆☆ Found in Text Mining only
Ovarian Diseases	Ovarian diseases	Pubtator	22246450	Inhibit	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	25875420, 29976975		★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	23242609		★☆☆☆☆ Found in Text Mining only
Patent ductus arteriosus	Patent ductus arteriosus	BEFREE	23242609		★☆☆☆☆ Found in Text Mining only
Patent ductus arteriosus	Patent ductus arteriosus	HPO_DG			★☆☆☆☆ Found in Text Mining only
Pelvic Organ Prolapse	Pelvic Organ Prolapse	BEFREE	30695788		★☆☆☆☆ Found in Text Mining only
Posterior embryotoxon	Posterior embryotoxon	HPO_DG			★☆☆☆☆ Found in Text Mining only
Primary congenital glaucoma	Congenital glaucoma	BEFREE	18708620, 21031026, 26220699, 30653210		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	11155740, 19220249, 21266046		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	CTD_human_DG	17199135		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	21266046, 32107877	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psoriasis	Psoriasis	BEFREE	30825251		★☆☆☆☆ Found in Text Mining only
Renal fibrosis	Renal fibrosis	BEFREE	23165112		★☆☆☆☆ Found in Text Mining only
Respiratory Tract Diseases	Respiratory system infectious disease	Pubtator	37925496	Associate	★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	29022182, 30060822, 3261054, 8310203		★☆☆☆☆ Found in Text Mining only
Rieger eye malformation sequence	Axenfeld anomaly	HPO_DG			★☆☆☆☆ Found in Text Mining only
Rieger syndrome	Rieger syndrome	ORPHANET_DG	11170889, 19513095, 9620769		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rieger syndrome	Rieger syndrome	BEFREE	11821690, 12614756, 14630904, 15477465		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rieger syndrome	Rieger syndrome	HPO_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Scleroderma	Scleroderma	BEFREE	6593111		★☆☆☆☆ Found in Text Mining only
Secondary Open Angle Glaucoma	Open Angle Glaucoma	CTD_human_DG	26752265		★☆☆☆☆ Found in Text Mining only
Sensorineural Hearing Loss (disorder)	Hearing Loss	HPO_DG			★☆☆☆☆ Found in Text Mining only
Spinocerebellar Ataxia 29	Spinocerebellar ataxia	Pubtator	19668217	Associate	★☆☆☆☆ Found in Text Mining only
Spinocerebellar Ataxia Type 1	Spinocerebellar Ataxia	CTD_human_DG	19668217		★☆☆☆☆ Found in Text Mining only
Spinocerebellar Ataxia Type 2	Spinocerebellar Ataxia	CTD_human_DG	19668217		★☆☆☆☆ Found in Text Mining only
Spinocerebellar Ataxia Type 4	Spinocerebellar Ataxia	CTD_human_DG	19668217		★☆☆☆☆ Found in Text Mining only
Spinocerebellar Ataxia Type 5	Spinocerebellar Ataxia	CTD_human_DG	19668217		★☆☆☆☆ Found in Text Mining only
Spinocerebellar Ataxia Type 6 (disorder)	Spinocerebellar Ataxia	CTD_human_DG	19668217		★☆☆☆☆ Found in Text Mining only
Spinocerebellar Ataxia Type 7	Spinocerebellar Ataxia	CTD_human_DG	19668217		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	24889262		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	25031703		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	24889262, 25130698	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of tongue	Tongue carcinoma	BEFREE	25130698		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	34957298	Associate	★☆☆☆☆ Found in Text Mining only
Strabismus	Strabismus	HPO_DG			★☆☆☆☆ Found in Text Mining only
Subcapsular cataract	Subcapsular cataract	HPO_DG			★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	6593111		★☆☆☆☆ Found in Text Mining only
Tetralogy of Fallot	Tetralogy of Fallot	CTD_human_DG	25093829		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Tetralogy of Fallot	Tetralogy of fallot	Pubtator	25093829	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid Carcinoma Anaplastic	Thyroid cancer	Pubtator	27796151	Associate	★☆☆☆☆ Found in Text Mining only
Tongue Neoplasms	Tongue cancer	Pubtator	25130698	Associate	★☆☆☆☆ Found in Text Mining only
Trichohepatoenteric Syndrome	Trichohepatoenteric Syndrome	BEFREE	22105932		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	28028927, 28493031, 29249801, 29754847, 30237308, 30290049, 31649243		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	28474731, 28493031, 31649243, 32406563, 34784418, 37796506	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	29328384	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Diseases	Uterine polyp	Pubtator	34082653	Associate	★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	29751260		★☆☆☆☆ Found in Text Mining only