Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	2295
Gene name	Forkhead box F2
Gene symbol	FOXF2
Synonyms (NCBI Gene)	FKHL6FREAC-2FREAC2
Chromosome	6
Chromosome location	6p25.3
Summary	FOXF2 encodes forkhead box F2, one of many human homologues of the Drosophila melanogaster transcription factor forkhead. FOXF2 is expressed in lung and placenta, and has been shown to transcriptionally activate several lung-specific genes. [provided by R

228

Show/Hide all (228)

miRTarBase ID	miRNA	Experiments	Reference
MIRT007330	hsa-miR-182-5p	Luciferase reporter assay	23383207
MIRT022115	hsa-miR-124-3p	Microarray	18668037
MIRT028797	hsa-miR-26b-5p	Microarray	19088304
MIRT612027	hsa-miR-8485	HITS-CLIP	23824327
MIRT612026	hsa-miR-346	HITS-CLIP	23824327
MIRT612025	hsa-miR-4288	HITS-CLIP	23824327
MIRT612024	hsa-miR-632	HITS-CLIP	23824327
MIRT612023	hsa-miR-1231	HITS-CLIP	23824327
MIRT612027	hsa-miR-8485	HITS-CLIP	23824327
MIRT612026	hsa-miR-346	HITS-CLIP	23824327
MIRT612025	hsa-miR-4288	HITS-CLIP	23824327
MIRT612024	hsa-miR-632	HITS-CLIP	23824327
MIRT612023	hsa-miR-1231	HITS-CLIP	23824327
MIRT612027	hsa-miR-8485	HITS-CLIP	23824327
MIRT612026	hsa-miR-346	HITS-CLIP	23824327
MIRT612025	hsa-miR-4288	HITS-CLIP	23824327
MIRT612024	hsa-miR-632	HITS-CLIP	23824327
MIRT612023	hsa-miR-1231	HITS-CLIP	23824327
MIRT612027	hsa-miR-8485	HITS-CLIP	23824327
MIRT612026	hsa-miR-346	HITS-CLIP	23824327
MIRT612025	hsa-miR-4288	HITS-CLIP	23824327
MIRT612024	hsa-miR-632	HITS-CLIP	23824327
MIRT612023	hsa-miR-1231	HITS-CLIP	23824327
MIRT612027	hsa-miR-8485	HITS-CLIP	23824327
MIRT612026	hsa-miR-346	HITS-CLIP	23824327
MIRT612025	hsa-miR-4288	HITS-CLIP	23824327
MIRT612024	hsa-miR-632	HITS-CLIP	23824327
MIRT612023	hsa-miR-1231	HITS-CLIP	23824327
MIRT612027	hsa-miR-8485	HITS-CLIP	23824327
MIRT612025	hsa-miR-4288	HITS-CLIP	23824327
MIRT612024	hsa-miR-632	HITS-CLIP	23824327
MIRT612023	hsa-miR-1231	HITS-CLIP	23824327
MIRT612027	hsa-miR-8485	HITS-CLIP	23824327
MIRT612026	hsa-miR-346	HITS-CLIP	23824327
MIRT612025	hsa-miR-4288	HITS-CLIP	23824327
MIRT612024	hsa-miR-632	HITS-CLIP	23824327
MIRT612023	hsa-miR-1231	HITS-CLIP	23824327
MIRT612027	hsa-miR-8485	HITS-CLIP	23824327
MIRT612026	hsa-miR-346	HITS-CLIP	23824327
MIRT612025	hsa-miR-4288	HITS-CLIP	23824327
MIRT612024	hsa-miR-632	HITS-CLIP	23824327
MIRT612023	hsa-miR-1231	HITS-CLIP	23824327
MIRT612027	hsa-miR-8485	HITS-CLIP	23824327
MIRT612025	hsa-miR-4288	HITS-CLIP	23824327
MIRT612024	hsa-miR-632	HITS-CLIP	23824327
MIRT612023	hsa-miR-1231	HITS-CLIP	23824327
MIRT612027	hsa-miR-8485	HITS-CLIP	23824327
MIRT612025	hsa-miR-4288	HITS-CLIP	23824327
MIRT612024	hsa-miR-632	HITS-CLIP	23824327
MIRT612023	hsa-miR-1231	HITS-CLIP	23824327
MIRT612027	hsa-miR-8485	HITS-CLIP	23824327
MIRT612026	hsa-miR-346	HITS-CLIP	23824327
MIRT612025	hsa-miR-4288	HITS-CLIP	23824327
MIRT612024	hsa-miR-632	HITS-CLIP	23824327
MIRT612023	hsa-miR-1231	HITS-CLIP	23824327
MIRT612027	hsa-miR-8485	HITS-CLIP	23824327
MIRT612026	hsa-miR-346	HITS-CLIP	23824327
MIRT612025	hsa-miR-4288	HITS-CLIP	23824327
MIRT612024	hsa-miR-632	HITS-CLIP	23824327
MIRT612023	hsa-miR-1231	HITS-CLIP	23824327
MIRT612027	hsa-miR-8485	HITS-CLIP	23824327
MIRT612026	hsa-miR-346	HITS-CLIP	23824327
MIRT612025	hsa-miR-4288	HITS-CLIP	23824327
MIRT612024	hsa-miR-632	HITS-CLIP	23824327
MIRT612023	hsa-miR-1231	HITS-CLIP	23824327
MIRT612027	hsa-miR-8485	HITS-CLIP	23824327
MIRT612026	hsa-miR-346	HITS-CLIP	23824327
MIRT612025	hsa-miR-4288	HITS-CLIP	23824327
MIRT612024	hsa-miR-632	HITS-CLIP	23824327
MIRT612023	hsa-miR-1231	HITS-CLIP	23824327
MIRT612027	hsa-miR-8485	HITS-CLIP	23824327
MIRT623911	hsa-miR-3140-3p	HITS-CLIP	23824327
MIRT612025	hsa-miR-4288	HITS-CLIP	23824327
MIRT612024	hsa-miR-632	HITS-CLIP	23824327
MIRT612023	hsa-miR-1231	HITS-CLIP	23824327
MIRT623914	hsa-miR-1228-3p	HITS-CLIP	23824327
MIRT623913	hsa-miR-3620-3p	HITS-CLIP	23824327
MIRT623912	hsa-miR-3920	HITS-CLIP	23824327
MIRT623911	hsa-miR-3140-3p	HITS-CLIP	23824327
MIRT623910	hsa-miR-377-3p	HITS-CLIP	23824327
MIRT623909	hsa-miR-5096	HITS-CLIP	23824327
MIRT623908	hsa-miR-335-3p	HITS-CLIP	23824327
MIRT612027	hsa-miR-8485	HITS-CLIP	23824327
MIRT612026	hsa-miR-346	HITS-CLIP	23824327
MIRT612025	hsa-miR-4288	HITS-CLIP	23824327
MIRT612024	hsa-miR-632	HITS-CLIP	23824327
MIRT612023	hsa-miR-1231	HITS-CLIP	23824327
MIRT612027	hsa-miR-8485	HITS-CLIP	23824327
MIRT612026	hsa-miR-346	HITS-CLIP	23824327
MIRT612025	hsa-miR-4288	HITS-CLIP	23824327
MIRT612024	hsa-miR-632	HITS-CLIP	23824327
MIRT612023	hsa-miR-1231	HITS-CLIP	23824327
MIRT612027	hsa-miR-8485	HITS-CLIP	23824327
MIRT612026	hsa-miR-346	HITS-CLIP	23824327
MIRT612025	hsa-miR-4288	HITS-CLIP	23824327
MIRT612024	hsa-miR-632	HITS-CLIP	23824327
MIRT612023	hsa-miR-1231	HITS-CLIP	23824327
MIRT612027	hsa-miR-8485	HITS-CLIP	23824327
MIRT612025	hsa-miR-4288	HITS-CLIP	23824327
MIRT612024	hsa-miR-632	HITS-CLIP	23824327
MIRT612023	hsa-miR-1231	HITS-CLIP	23824327
MIRT612027	hsa-miR-8485	HITS-CLIP	23824327
MIRT612026	hsa-miR-346	HITS-CLIP	23824327
MIRT612025	hsa-miR-4288	HITS-CLIP	23824327
MIRT612024	hsa-miR-632	HITS-CLIP	23824327
MIRT612023	hsa-miR-1231	HITS-CLIP	23824327
MIRT098706	hsa-miR-519a-3p	Luciferase reporter assayqRT-PCRWestern blot	26693396
MIRT098706	hsa-miR-519a-3p	Luciferase reporter assayqRT-PCRWestern blot	26693396
MIRT737446	hsa-miR-182-3p	Western blottingqRT-PCR	31933939
MIRT612027	hsa-miR-8485	HITS-CLIP	23824327
MIRT612026	hsa-miR-346	HITS-CLIP	23824327
MIRT612025	hsa-miR-4288	HITS-CLIP	23824327
MIRT612024	hsa-miR-632	HITS-CLIP	23824327
MIRT612023	hsa-miR-1231	HITS-CLIP	23824327
MIRT612027	hsa-miR-8485	HITS-CLIP	23824327
MIRT612026	hsa-miR-346	HITS-CLIP	23824327
MIRT612025	hsa-miR-4288	HITS-CLIP	23824327
MIRT612024	hsa-miR-632	HITS-CLIP	23824327
MIRT612023	hsa-miR-1231	HITS-CLIP	23824327
MIRT612027	hsa-miR-8485	HITS-CLIP	23824327
MIRT612026	hsa-miR-346	HITS-CLIP	23824327
MIRT612025	hsa-miR-4288	HITS-CLIP	23824327
MIRT612024	hsa-miR-632	HITS-CLIP	23824327
MIRT612023	hsa-miR-1231	HITS-CLIP	23824327
MIRT612027	hsa-miR-8485	HITS-CLIP	23824327
MIRT612026	hsa-miR-346	HITS-CLIP	23824327
MIRT612025	hsa-miR-4288	HITS-CLIP	23824327
MIRT612024	hsa-miR-632	HITS-CLIP	23824327
MIRT612023	hsa-miR-1231	HITS-CLIP	23824327
MIRT612027	hsa-miR-8485	HITS-CLIP	23824327
MIRT612026	hsa-miR-346	HITS-CLIP	23824327
MIRT612025	hsa-miR-4288	HITS-CLIP	23824327
MIRT612024	hsa-miR-632	HITS-CLIP	23824327
MIRT612023	hsa-miR-1231	HITS-CLIP	23824327
MIRT612027	hsa-miR-8485	HITS-CLIP	23824327
MIRT612025	hsa-miR-4288	HITS-CLIP	23824327
MIRT612024	hsa-miR-632	HITS-CLIP	23824327
MIRT612023	hsa-miR-1231	HITS-CLIP	23824327
MIRT612027	hsa-miR-8485	HITS-CLIP	23824327
MIRT612026	hsa-miR-346	HITS-CLIP	23824327
MIRT612025	hsa-miR-4288	HITS-CLIP	23824327
MIRT612024	hsa-miR-632	HITS-CLIP	23824327
MIRT612023	hsa-miR-1231	HITS-CLIP	23824327
MIRT612027	hsa-miR-8485	HITS-CLIP	23824327
MIRT612026	hsa-miR-346	HITS-CLIP	23824327
MIRT612025	hsa-miR-4288	HITS-CLIP	23824327
MIRT612024	hsa-miR-632	HITS-CLIP	23824327
MIRT612023	hsa-miR-1231	HITS-CLIP	23824327
MIRT612027	hsa-miR-8485	HITS-CLIP	23824327
MIRT612025	hsa-miR-4288	HITS-CLIP	23824327
MIRT612024	hsa-miR-632	HITS-CLIP	23824327
MIRT612023	hsa-miR-1231	HITS-CLIP	23824327
MIRT612027	hsa-miR-8485	HITS-CLIP	23824327
MIRT612025	hsa-miR-4288	HITS-CLIP	23824327
MIRT612024	hsa-miR-632	HITS-CLIP	23824327
MIRT612023	hsa-miR-1231	HITS-CLIP	23824327
MIRT612027	hsa-miR-8485	HITS-CLIP	23824327
MIRT612026	hsa-miR-346	HITS-CLIP	23824327
MIRT612025	hsa-miR-4288	HITS-CLIP	23824327
MIRT612024	hsa-miR-632	HITS-CLIP	23824327
MIRT612023	hsa-miR-1231	HITS-CLIP	23824327
MIRT612027	hsa-miR-8485	HITS-CLIP	23824327
MIRT612026	hsa-miR-346	HITS-CLIP	23824327
MIRT612025	hsa-miR-4288	HITS-CLIP	23824327
MIRT612024	hsa-miR-632	HITS-CLIP	23824327
MIRT612023	hsa-miR-1231	HITS-CLIP	23824327
MIRT612027	hsa-miR-8485	HITS-CLIP	23824327
MIRT612026	hsa-miR-346	HITS-CLIP	23824327
MIRT612025	hsa-miR-4288	HITS-CLIP	23824327
MIRT612024	hsa-miR-632	HITS-CLIP	23824327
MIRT612023	hsa-miR-1231	HITS-CLIP	23824327
MIRT612027	hsa-miR-8485	HITS-CLIP	23824327
MIRT612026	hsa-miR-346	HITS-CLIP	23824327
MIRT612025	hsa-miR-4288	HITS-CLIP	23824327
MIRT612024	hsa-miR-632	HITS-CLIP	23824327
MIRT612023	hsa-miR-1231	HITS-CLIP	23824327
MIRT612027	hsa-miR-8485	HITS-CLIP	23824327
MIRT623911	hsa-miR-3140-3p	HITS-CLIP	23824327
MIRT612025	hsa-miR-4288	HITS-CLIP	23824327
MIRT612024	hsa-miR-632	HITS-CLIP	23824327
MIRT612023	hsa-miR-1231	HITS-CLIP	23824327
MIRT623914	hsa-miR-1228-3p	HITS-CLIP	23824327
MIRT623913	hsa-miR-3620-3p	HITS-CLIP	23824327
MIRT623912	hsa-miR-3920	HITS-CLIP	23824327
MIRT623911	hsa-miR-3140-3p	HITS-CLIP	23824327
MIRT623910	hsa-miR-377-3p	HITS-CLIP	23824327
MIRT623909	hsa-miR-5096	HITS-CLIP	23824327
MIRT623908	hsa-miR-335-3p	HITS-CLIP	23824327
MIRT612027	hsa-miR-8485	HITS-CLIP	23824327
MIRT612026	hsa-miR-346	HITS-CLIP	23824327
MIRT612025	hsa-miR-4288	HITS-CLIP	23824327
MIRT612024	hsa-miR-632	HITS-CLIP	23824327
MIRT612023	hsa-miR-1231	HITS-CLIP	23824327
MIRT612027	hsa-miR-8485	HITS-CLIP	23824327
MIRT612026	hsa-miR-346	HITS-CLIP	23824327
MIRT612025	hsa-miR-4288	HITS-CLIP	23824327
MIRT612024	hsa-miR-632	HITS-CLIP	23824327
MIRT612023	hsa-miR-1231	HITS-CLIP	23824327
MIRT612027	hsa-miR-8485	HITS-CLIP	23824327
MIRT612026	hsa-miR-346	HITS-CLIP	23824327
MIRT612025	hsa-miR-4288	HITS-CLIP	23824327
MIRT612024	hsa-miR-632	HITS-CLIP	23824327
MIRT612023	hsa-miR-1231	HITS-CLIP	23824327
MIRT612027	hsa-miR-8485	HITS-CLIP	23824327
MIRT612025	hsa-miR-4288	HITS-CLIP	23824327
MIRT612024	hsa-miR-632	HITS-CLIP	23824327
MIRT612023	hsa-miR-1231	HITS-CLIP	23824327
MIRT612027	hsa-miR-8485	HITS-CLIP	23824327
MIRT612026	hsa-miR-346	HITS-CLIP	23824327
MIRT612025	hsa-miR-4288	HITS-CLIP	23824327
MIRT612024	hsa-miR-632	HITS-CLIP	23824327
MIRT612023	hsa-miR-1231	HITS-CLIP	23824327
MIRT1548884	hsa-miR-185	CLIP-seq
MIRT1548885	hsa-miR-3150b-3p	CLIP-seq
MIRT1548886	hsa-miR-3175	CLIP-seq
MIRT1548887	hsa-miR-4306	CLIP-seq
MIRT1548888	hsa-miR-4529-5p	CLIP-seq
MIRT1548889	hsa-miR-4644	CLIP-seq
MIRT1548890	hsa-miR-4779	CLIP-seq
MIRT1548891	hsa-miR-4784	CLIP-seq
MIRT1548884	hsa-miR-185	CLIP-seq
MIRT1548885	hsa-miR-3150b-3p	CLIP-seq
MIRT1548886	hsa-miR-3175	CLIP-seq
MIRT1548887	hsa-miR-4306	CLIP-seq
MIRT1548888	hsa-miR-4529-5p	CLIP-seq
MIRT1548889	hsa-miR-4644	CLIP-seq
MIRT1548890	hsa-miR-4779	CLIP-seq
MIRT1548891	hsa-miR-4784	CLIP-seq

Show/Hide all (39)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	ISA
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IDA	8626802
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001093	Function	TFIIB-class transcription factor binding	IPI	9722567
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IDA	8626802
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IMP	8626802
GO:0001837	Process	Epithelial to mesenchymal transition	NAS	19220249
GO:0003677	Function	DNA binding	IDA	7957066
GO:0003677	Function	DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IDA	9722567
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IC	8626802
GO:0005634	Component	Nucleus	IDA	9722567, 9799607, 29374064
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005667	Component	Transcription regulator complex	IDA	9722567
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0009887	Process	Animal organ morphogenesis	IBA
GO:0016604	Component	Nuclear body	IDA
GO:0030198	Process	Extracellular matrix organization	IEA
GO:0032434	Process	Regulation of proteasomal ubiquitin-dependent protein catabolic process	IDA	29374064
GO:0042249	Process	Establishment of planar polarity of embryonic epithelium	IEA
GO:0043565	Function	Sequence-specific DNA binding	IDA	7957066, 8626802
GO:0043565	Function	Sequence-specific DNA binding	IEA
GO:0045892	Process	Negative regulation of DNA-templated transcription	IEA
GO:0045893	Process	Positive regulation of DNA-templated transcription	IDA	8626802
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	8626802
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IMP	8626802
GO:0048566	Process	Embryonic digestive tract development	IEA
GO:0048596	Process	Embryonic camera-type eye morphogenesis	IEA
GO:0048731	Process	System development	IEA
GO:0048806	Process	Genitalia development	IMP	19276632
GO:0060021	Process	Roof of mouth development	IMP	19276632
GO:0140296	Function	General transcription initiation factor binding	IPI	9722567
GO:1902914	Process	Regulation of protein polyubiquitination	IDA	29374064

MIM	HGNC	e!Ensembl
603250	3810	ENSG00000137273

Q12947

Protein name

Forkhead box protein F2 (Forkhead-related activator 2) (FREAC-2) (Forkhead-related protein FKHL6) (Forkhead-related transcription factor 2)

Protein function

Probable transcription activator for a number of lung-specific genes (PubMed:8626802). Mediates up-regulation of the E3 ligase IRF2BPL and drives ubiquitination and degradation of CTNNB1 (PubMed:29374064). {ECO:0000269|PubMed:29374064, ECO:00002

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00250	Forkhead	99 → 185	Forkhead domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Lung and placenta (PubMed:8626802). Predominantly expressed in gastrointestinal tract including stomach (PubMed:29374064). {ECO:0000269|PubMed:29374064, ECO:0000269|PubMed:8626802}.

Sequence

MTTEGGPPPAPLRRACSPVPGALQAALMSPPPAAAAAAAAAPETTSSSSSSSSASCASSS
SSSNSASAPSAACKSAGGGGAGAGSGGAKKASSGLRRPEKPPYSYIALIVMAIQSSPSKR
LTLSEIYQFLQARFPFFRGAYQGWKNSVRHNLSLNECFIKLPKGLGRPGKGHYWTIDPAS
EFMFEEGSFRRRPRGFRRKCQALKPMYHRVVSGLGFGASLLPQGFDFQAPPSAPLGCHSQ
GGYGGLDMMPAGYDAGAGAPSHAHPHHHHHHHVPHMSPNPGSTYMASCPVPAGPGGVGAA
GGGGGGDYGPDSSSSPVPSSPAMASAIECHSPYTSPAAHWSSPGASPYLKQPPALTPSSN
PAASAGLHSSMSSYSLEQSYLHQNAREDLSVGLPRYQHHSTPVCDRKDFVLNFNGISSFH
PSASGSYYHHHHQSVCQDIKPCVM

Sequence length

444

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (11)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ANDROGENETIC ALOPECIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CEREBROVASCULAR ACCIDENT	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ERECTILE DYSFUNCTION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FOXF2-related disorder	Likely benign; Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOOD DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN SEROUS CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STROKE	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
URINARY BLADDER CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (50)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute Cerebrovascular Accidents	Stroke	CTD_human_DG	29531354		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma of large intestine	Colorectal adenoma	BEFREE	25738520		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alveolar rhabdomyosarcoma	Alveolar Rhabdomyosarcoma	BEFREE	27425595		★★★★★ ★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	19220249		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	23620774, 25848863, 26070560, 27377963, 30285803, 31222004		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	23620774, 26070560, 28829888, 35660418	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	26210254	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchopulmonary Dysplasia	Bronchopulmonary Dysplasia	BEFREE	30459472		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchopulmonary Dysplasia	Bronchopulmonary dysplasia	Pubtator	30459472	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	27068588		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	27068588		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cerebrovascular accident	Stroke	CTD_human_DG	29531354		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
cervical cancer	Cervical Cancer	BEFREE	30249755		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	30249755		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cleft Lip with or without Cleft Palate	Cleft Lip With Or Without Cleft Palate	BEFREE	26278207		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cleft Palate	Cleft palate	Pubtator	19276632, 30917284	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	25738520, 28849155		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	28849155, 30987631, 32103872	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital absence of uvula	Absent uvula	BEFREE	30917284		★★★★★ ★☆☆☆☆ Found in Text Mining only
Developmental Disabilities	Developmental disability	Pubtator	19276632	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Disorders of Sex Development	Disorders of sex development	Pubtator	19276632	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	36373483	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	28222662	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Diseases	Gastrointestinal Diseases	BEFREE	30565344		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastroparesis	Gastroparesis	BEFREE	30565344		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	27068588		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	25824262, 28582850		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	28829888	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	28222662, 32103872	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic Metastasis	BEFREE	29409810		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	23620774, 25848863, 26070560, 27377963, 30285803, 31222004		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	19220249		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	29374064		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	19220249, 28222662, 28577976, 30807702		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	30249755		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	27377963		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	23383207, 23620774, 25824262, 27377963, 27425595, 29374064, 30285803		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	27487137, 28766235		★★★★★ ★☆☆☆☆ Found in Text Mining only
Partial Trisomy	Trisomy	BEFREE	22407547		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	19220249		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Hyperplasia	Prostatic hyperplasia	Pubtator	37705744	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	BEFREE	27425595		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sensorineural Hearing Loss (disorder)	Hearing Loss	BEFREE	30561639		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sex Differentiation Disorders	Sex Differentiation Disorders	BEFREE	19276632		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	28222662		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	32014885	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	29374064		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	23620774, 25848863, 26210254, 28043147, 29085483		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	23620774, 26210254	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uranostaphyloschisis	Uranostaphyloschisis	BEFREE	19276632, 26745863		★★★★★ ★☆☆☆☆ Found in Text Mining only

FOXF2 (forkhead box F2)