Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	22949
Gene name	Prostaglandin reductase 1
Gene symbol	PTGR1
Synonyms (NCBI Gene)	DIG-1LTB4DHPGR1ZADH3
Chromosome	9
Chromosome location	9q31.3
Summary	This gene encodes an enzyme that is involved in the inactivation of the chemotactic factor, leukotriene B4. The encoded protein specifically catalyzes the NADP+ dependent conversion of leukotriene B4 to 12-oxo-leukotriene B4. A pseudogene of this gene is

Show/Hide all (7)

miRTarBase ID	miRNA	Experiments
MIRT1273256	hsa-miR-1911	CLIP-seq
MIRT1273257	hsa-miR-208a	CLIP-seq
MIRT1273258	hsa-miR-208b	CLIP-seq
MIRT1273259	hsa-miR-3617	CLIP-seq
MIRT1273260	hsa-miR-4528	CLIP-seq
MIRT1273261	hsa-miR-499-5p	CLIP-seq
MIRT1273262	hsa-miR-641	CLIP-seq

Show/Hide all (23)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	32814053
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	ISS
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006631	Process	Fatty acid metabolic process	IEA
GO:0006691	Process	Leukotriene metabolic process	NAS	8576264
GO:0006693	Process	Prostaglandin metabolic process	IBA
GO:0006693	Process	Prostaglandin metabolic process	IDA	25619643
GO:0006693	Process	Prostaglandin metabolic process	IEA
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0016628	Function	Oxidoreductase activity, acting on the CH-CH group of donors, NAD or NADP as acceptor	IEA
GO:0032440	Function	2-alkenal reductase [NAD(P)H] activity	IEA
GO:0035798	Function	2-alkenal reductase (NADPH) activity	IDA	25619643
GO:0035798	Function	2-alkenal reductase (NADPH) activity	IEA
GO:0036102	Process	Leukotriene B4 metabolic process	ISS
GO:0036185	Function	13-lipoxin reductase activity	ISS
GO:0047522	Function	15-oxoprostaglandin 13-reductase [NAD(P)+] activity	IBA
GO:0047522	Function	15-oxoprostaglandin 13-reductase [NAD(P)+] activity	IDA	25619643
GO:0047522	Function	15-oxoprostaglandin 13-reductase [NAD(P)+] activity	IEA
GO:0070062	Component	Extracellular exosome	HDA	19056867
GO:0097257	Function	Leukotriene B4 12-hydroxy dehydrogenase activity	IEA
GO:0097257	Function	Leukotriene B4 12-hydroxy dehydrogenase activity	ISS
GO:2001302	Process	Lipoxin A4 metabolic process	ISS

MIM	HGNC	e!Ensembl
601274	18429	ENSG00000106853

Q14914

Protein name

Prostaglandin reductase 1 (PRG-1) (15-oxoprostaglandin 13-reductase) (EC 1.3.1.48) (Dithiolethione-inducible gene 1 protein) (D3T-inducible gene 1 protein) (DIG-1) (Leukotriene B4 12-hydroxydehydrogenase) (NAD(P)H-dependent alkenal/one oxidoreductase) (EC

Protein function

NAD(P)H-dependent oxidoreductase involved in metabolic inactivation of pro- and anti-inflammatory eicosanoids: prostaglandins (PG), leukotrienes (LT) and lipoxins (LX) (PubMed:25619643). Catalyzes with high efficiency the reduction of the 13,14

PDB

1ZSV , 2Y05

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF16884	ADH_N_2	5 → 105	N-terminal domain of oxidoreductase	Family
PF00107	ADH_zinc_N	153 → 293	Zinc-binding dehydrogenase	Family

Tissue specificity

TISSUE SPECIFICITY: High expression in the kidney, liver, and intestine but not in leukocytes. {ECO:0000269|PubMed:8576264}.

Sequence

MVRTKTWTLKKHFVGYPTNSDFELKTAELPPLKNGEVLLEALFLTVDPYMRVAAKRLKEG
DTMMGQQVAKVVESKNVALPKGTIVLASPGWTTHSISDGKDLEKLLTEWPDTIPLSLALG
TVGMPGLTAYFGLLEICGVKGGETVMVNAAAGAVGSVVGQIAKLKGCKVVGAVGSDEKVA
YLQKLGFDVVFNYKTVESLEETLKKASPDGYDCYFDNVGGEFSNTVIGQMKKFGRIAICG
AISTYNRTGPLPPGPPPEIVIYQELRMEAFVVYRWQGDARQKALKDLLKWVLEGKIQYKE
YIIEGFENMPAAFMGMLKGDNLGKTIVKA

Sequence length

329

Interactions

View interactions

	KEGG
	Arachidonic acid metabolism

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
AUTISM SPECTRUM DISORDER	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDERS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (29)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Breast Carcinoma	Breast Carcinoma	BEFREE	30462268, 30779852		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	27429979	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	30630697	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	19595472, 27429979		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	37996508	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	34504628	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	31724326	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	27116978, 29966699		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	27116978	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	27116978, 29966699		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	21687936, 24853774, 27867096		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	21687936		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	27429979	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	28117410	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant mesothelioma	Malignant Mesothelioma	BEFREE	15639718		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	30462268, 30779852		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	19595472, 27429979		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	27150108		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	24853774, 26823768, 27429979		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental disorders	Mental Disorders	BEFREE	26671989, 28843862		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	21687936, 24853774		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	27429979, 30336981		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	27150108		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	27150108, 37582751	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	38256104	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	26823768		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	26823768	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	29471829	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	25907251	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

PTGR1 (prostaglandin reductase 1)