Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	22943
Gene name	Dickkopf Wnt signaling pathway inhibitor 1
Gene symbol	DKK1
Synonyms (NCBI Gene)	DKK-1SK
Chromosome	10
Chromosome location	10q21.1
Summary	This gene encodes a member of the dickkopf family of proteins. Members of this family are secreted proteins characterized by two cysteine-rich domains that mediate protein-protein interactions. The encoded protein binds to the LRP6 co-receptor and inhibit

355

Show/Hide all (355)

miRTarBase ID	miRNA	Experiments	Reference
MIRT003609	hsa-miR-29a-3p	Luciferase reporter assayqRT-PCRWestern blot	20551325
MIRT005874	hsa-miR-31-5p	ImmunoprecipitaionLuciferase reporter assayMicroarrayqRT-PCRWestern blot	21048943
MIRT005874	hsa-miR-31-5p	ImmunoprecipitaionLuciferase reporter assayMicroarrayqRT-PCRWestern blot	21048943
MIRT005874	hsa-miR-31-5p	ImmunoprecipitaionLuciferase reporter assayMicroarrayqRT-PCRWestern blot	21048943
MIRT005874	hsa-miR-31-5p	ImmunoprecipitaionLuciferase reporter assayMicroarrayqRT-PCRWestern blot	21048943
MIRT005874	hsa-miR-31-5p	ImmunoprecipitaionLuciferase reporter assayMicroarrayqRT-PCRWestern blot	21048943
MIRT023613	hsa-miR-1-3p	Microarray	18668037
MIRT052959	hsa-miR-371a-3p	Luciferase reporter assayqRT-PCRWestern blot	22020335
MIRT053299	hsa-miR-372-3p	Luciferase reporter assayqRT-PCRWestern blot	22020335
MIRT053300	hsa-miR-373-3p	Luciferase reporter assayqRT-PCRWestern blot	22020335
MIRT732132	hsa-miR-493-3p	ELISAImmunohistochemistryLuciferase reporter assayqRT-PCRWestern blot	26799283
MIRT732132	hsa-miR-493-3p	ELISAImmunohistochemistryLuciferase reporter assayqRT-PCRWestern blot	26799283
MIRT732132	hsa-miR-493-3p	ELISAImmunohistochemistryLuciferase reporter assayqRT-PCRWestern blot	26799283
MIRT732132	hsa-miR-493-3p	ELISAImmunohistochemistryLuciferase reporter assayqRT-PCRWestern blot	26799283
MIRT053300	hsa-miR-373-3p	Luciferase reporter assayqRT-PCRWestern blot	28337453
MIRT053300	hsa-miR-373-3p	Luciferase reporter assayqRT-PCRWestern blot	28337453
MIRT736120	hsa-miR-335-5p	qRT-PCRWestern blot	26986081
MIRT733475	hsa-miR-106a-5p	qRT-PCR	34184078
MIRT733476	hsa-miR-103a-3p	qRT-PCR	34184078
MIRT735711	hsa-miR-107	Luciferase reporter assayWestern blottingqRT-PCR	34234100
MIRT736120	hsa-miR-335-5p	Luciferase reporter assayWestern blottingqRT-PCR	31679313
MIRT735711	hsa-miR-107	Luciferase reporter assayWestern blottingImmunoprecipitaion (IP)qRT-PCRFlow cytometry	34234100
MIRT756012	hsa-miR-5584-3p	Luciferase reporter assayWestern blottingqRT-PCRRNA-seq	38883346
MIRT937543	hsa-miR-101	CLIP-seq
MIRT937544	hsa-miR-103a	CLIP-seq
MIRT937545	hsa-miR-103b	CLIP-seq
MIRT937546	hsa-miR-1227	CLIP-seq
MIRT937547	hsa-miR-1261	CLIP-seq
MIRT937548	hsa-miR-140-3p	CLIP-seq
MIRT937549	hsa-miR-144	CLIP-seq
MIRT937550	hsa-miR-148a	CLIP-seq
MIRT937551	hsa-miR-148b	CLIP-seq
MIRT937552	hsa-miR-152	CLIP-seq
MIRT937553	hsa-miR-186	CLIP-seq
MIRT937554	hsa-miR-203	CLIP-seq
MIRT937555	hsa-miR-217	CLIP-seq
MIRT937556	hsa-miR-219-1-3p	CLIP-seq
MIRT937557	hsa-miR-223	CLIP-seq
MIRT937558	hsa-miR-2682	CLIP-seq
MIRT937559	hsa-miR-302a	CLIP-seq
MIRT937560	hsa-miR-302b	CLIP-seq
MIRT937561	hsa-miR-302c	CLIP-seq
MIRT937562	hsa-miR-302d	CLIP-seq
MIRT937563	hsa-miR-302e	CLIP-seq
MIRT937564	hsa-miR-3064-3p	CLIP-seq
MIRT937565	hsa-miR-3065-3p	CLIP-seq
MIRT937566	hsa-miR-3125	CLIP-seq
MIRT937567	hsa-miR-3133	CLIP-seq
MIRT937568	hsa-miR-3140-3p	CLIP-seq
MIRT937569	hsa-miR-3148	CLIP-seq
MIRT937570	hsa-miR-3159	CLIP-seq
MIRT937571	hsa-miR-3163	CLIP-seq
MIRT937572	hsa-miR-320e	CLIP-seq
MIRT937573	hsa-miR-329	CLIP-seq
MIRT937574	hsa-miR-331-5p	CLIP-seq
MIRT937575	hsa-miR-338-5p	CLIP-seq
MIRT937576	hsa-miR-33a	CLIP-seq
MIRT937577	hsa-miR-33b	CLIP-seq
MIRT937578	hsa-miR-34a	CLIP-seq
MIRT937579	hsa-miR-34c-5p	CLIP-seq
MIRT937580	hsa-miR-3613-3p	CLIP-seq
MIRT937581	hsa-miR-362-3p	CLIP-seq
MIRT937582	hsa-miR-362-5p	CLIP-seq
MIRT937583	hsa-miR-3653	CLIP-seq
MIRT937584	hsa-miR-3658	CLIP-seq
MIRT937585	hsa-miR-3682-5p	CLIP-seq
MIRT937586	hsa-miR-372	CLIP-seq
MIRT937587	hsa-miR-373	CLIP-seq
MIRT937588	hsa-miR-376a	CLIP-seq
MIRT937589	hsa-miR-376b	CLIP-seq
MIRT937590	hsa-miR-3916	CLIP-seq
MIRT937591	hsa-miR-3921	CLIP-seq
MIRT937592	hsa-miR-3941	CLIP-seq
MIRT937593	hsa-miR-3942-3p	CLIP-seq
MIRT937594	hsa-miR-3944-5p	CLIP-seq
MIRT937595	hsa-miR-3974	CLIP-seq
MIRT937596	hsa-miR-410	CLIP-seq
MIRT937597	hsa-miR-4251	CLIP-seq
MIRT937598	hsa-miR-4277	CLIP-seq
MIRT937599	hsa-miR-4282	CLIP-seq
MIRT937600	hsa-miR-4305	CLIP-seq
MIRT937601	hsa-miR-4317	CLIP-seq
MIRT937602	hsa-miR-4418	CLIP-seq
MIRT937603	hsa-miR-4420	CLIP-seq
MIRT937604	hsa-miR-449a	CLIP-seq
MIRT937605	hsa-miR-449b	CLIP-seq
MIRT937606	hsa-miR-449c	CLIP-seq
MIRT937607	hsa-miR-4503	CLIP-seq
MIRT937608	hsa-miR-4509	CLIP-seq
MIRT937609	hsa-miR-4511	CLIP-seq
MIRT937610	hsa-miR-4653-5p	CLIP-seq
MIRT937611	hsa-miR-4662a-3p	CLIP-seq
MIRT937612	hsa-miR-4694-3p	CLIP-seq
MIRT937613	hsa-miR-4697-3p	CLIP-seq
MIRT937614	hsa-miR-4699-3p	CLIP-seq
MIRT937615	hsa-miR-4705	CLIP-seq
MIRT937616	hsa-miR-4768-5p	CLIP-seq
MIRT937617	hsa-miR-4773	CLIP-seq
MIRT937618	hsa-miR-4777-5p	CLIP-seq
MIRT937619	hsa-miR-4789-3p	CLIP-seq
MIRT937620	hsa-miR-493	CLIP-seq
MIRT937621	hsa-miR-500b	CLIP-seq
MIRT937622	hsa-miR-502-5p	CLIP-seq
MIRT937623	hsa-miR-509-3-5p	CLIP-seq
MIRT937624	hsa-miR-5095	CLIP-seq
MIRT937625	hsa-miR-509-5p	CLIP-seq
MIRT937626	hsa-miR-511	CLIP-seq
MIRT937627	hsa-miR-513a-3p	CLIP-seq
MIRT937628	hsa-miR-513a-5p	CLIP-seq
MIRT937629	hsa-miR-518d-5p	CLIP-seq
MIRT937630	hsa-miR-519a	CLIP-seq
MIRT937631	hsa-miR-519b-3p	CLIP-seq
MIRT937632	hsa-miR-519b-5p	CLIP-seq
MIRT937633	hsa-miR-519c-3p	CLIP-seq
MIRT937634	hsa-miR-519c-5p	CLIP-seq
MIRT937635	hsa-miR-520a-3p	CLIP-seq
MIRT937636	hsa-miR-520b	CLIP-seq
MIRT937637	hsa-miR-520c-3p	CLIP-seq
MIRT937638	hsa-miR-520c-5p	CLIP-seq
MIRT937639	hsa-miR-520d-3p	CLIP-seq
MIRT937640	hsa-miR-520e	CLIP-seq
MIRT937641	hsa-miR-522	CLIP-seq
MIRT937642	hsa-miR-526a	CLIP-seq
MIRT937643	hsa-miR-548ae	CLIP-seq
MIRT937644	hsa-miR-548aj	CLIP-seq
MIRT937645	hsa-miR-548am	CLIP-seq
MIRT937646	hsa-miR-548b-3p	CLIP-seq
MIRT937647	hsa-miR-548n	CLIP-seq
MIRT937648	hsa-miR-548t	CLIP-seq
MIRT937649	hsa-miR-548x	CLIP-seq
MIRT937650	hsa-miR-552	CLIP-seq
MIRT937651	hsa-miR-561	CLIP-seq
MIRT937652	hsa-miR-568	CLIP-seq
MIRT937653	hsa-miR-571	CLIP-seq
MIRT937654	hsa-miR-579	CLIP-seq
MIRT937655	hsa-miR-580	CLIP-seq
MIRT937656	hsa-miR-587	CLIP-seq
MIRT937657	hsa-miR-590-3p	CLIP-seq
MIRT937658	hsa-miR-603	CLIP-seq
MIRT937659	hsa-miR-607	CLIP-seq
MIRT937660	hsa-miR-616	CLIP-seq
MIRT937661	hsa-miR-643	CLIP-seq
MIRT937662	hsa-miR-651	CLIP-seq
MIRT937663	hsa-miR-940	CLIP-seq
MIRT1977534	hsa-miR-1	CLIP-seq
MIRT937543	hsa-miR-101	CLIP-seq
MIRT937544	hsa-miR-103a	CLIP-seq
MIRT937545	hsa-miR-103b	CLIP-seq
MIRT937546	hsa-miR-1227	CLIP-seq
MIRT937547	hsa-miR-1261	CLIP-seq
MIRT937548	hsa-miR-140-3p	CLIP-seq
MIRT937549	hsa-miR-144	CLIP-seq
MIRT1977535	hsa-miR-1468	CLIP-seq
MIRT937550	hsa-miR-148a	CLIP-seq
MIRT937551	hsa-miR-148b	CLIP-seq
MIRT937552	hsa-miR-152	CLIP-seq
MIRT937554	hsa-miR-203	CLIP-seq
MIRT1977536	hsa-miR-206	CLIP-seq
MIRT937555	hsa-miR-217	CLIP-seq
MIRT937556	hsa-miR-219-1-3p	CLIP-seq
MIRT937557	hsa-miR-223	CLIP-seq
MIRT937558	hsa-miR-2682	CLIP-seq
MIRT1977537	hsa-miR-297	CLIP-seq
MIRT937559	hsa-miR-302a	CLIP-seq
MIRT937560	hsa-miR-302b	CLIP-seq
MIRT937561	hsa-miR-302c	CLIP-seq
MIRT937562	hsa-miR-302d	CLIP-seq
MIRT937563	hsa-miR-302e	CLIP-seq
MIRT937564	hsa-miR-3064-3p	CLIP-seq
MIRT937565	hsa-miR-3065-3p	CLIP-seq
MIRT937566	hsa-miR-3125	CLIP-seq
MIRT937568	hsa-miR-3140-3p	CLIP-seq
MIRT1977538	hsa-miR-3143	CLIP-seq
MIRT1977539	hsa-miR-3145-3p	CLIP-seq
MIRT937569	hsa-miR-3148	CLIP-seq
MIRT1977540	hsa-miR-3156-5p	CLIP-seq
MIRT937570	hsa-miR-3159	CLIP-seq
MIRT937571	hsa-miR-3163	CLIP-seq
MIRT1977541	hsa-miR-3202	CLIP-seq
MIRT937572	hsa-miR-320e	CLIP-seq
MIRT937574	hsa-miR-331-5p	CLIP-seq
MIRT937575	hsa-miR-338-5p	CLIP-seq
MIRT937578	hsa-miR-34a	CLIP-seq
MIRT937579	hsa-miR-34c-5p	CLIP-seq
MIRT1977542	hsa-miR-3618	CLIP-seq
MIRT937582	hsa-miR-362-5p	CLIP-seq
MIRT937583	hsa-miR-3653	CLIP-seq
MIRT937584	hsa-miR-3658	CLIP-seq
MIRT1977543	hsa-miR-3673	CLIP-seq
MIRT1977544	hsa-miR-3674	CLIP-seq
MIRT937585	hsa-miR-3682-5p	CLIP-seq
MIRT937586	hsa-miR-372	CLIP-seq
MIRT937587	hsa-miR-373	CLIP-seq
MIRT937588	hsa-miR-376a	CLIP-seq
MIRT937589	hsa-miR-376b	CLIP-seq
MIRT937590	hsa-miR-3916	CLIP-seq
MIRT937593	hsa-miR-3942-3p	CLIP-seq
MIRT937594	hsa-miR-3944-5p	CLIP-seq
MIRT937595	hsa-miR-3974	CLIP-seq
MIRT937596	hsa-miR-410	CLIP-seq
MIRT937597	hsa-miR-4251	CLIP-seq
MIRT937598	hsa-miR-4277	CLIP-seq
MIRT937599	hsa-miR-4282	CLIP-seq
MIRT937600	hsa-miR-4305	CLIP-seq
MIRT1977545	hsa-miR-433	CLIP-seq
MIRT937602	hsa-miR-4418	CLIP-seq
MIRT937603	hsa-miR-4420	CLIP-seq
MIRT937604	hsa-miR-449a	CLIP-seq
MIRT937605	hsa-miR-449b	CLIP-seq
MIRT937606	hsa-miR-449c	CLIP-seq
MIRT937607	hsa-miR-4503	CLIP-seq
MIRT937608	hsa-miR-4509	CLIP-seq
MIRT937609	hsa-miR-4511	CLIP-seq
MIRT1977546	hsa-miR-4533	CLIP-seq
MIRT937611	hsa-miR-4662a-3p	CLIP-seq
MIRT937612	hsa-miR-4694-3p	CLIP-seq
MIRT1977547	hsa-miR-4694-5p	CLIP-seq
MIRT937613	hsa-miR-4697-3p	CLIP-seq
MIRT1977548	hsa-miR-4698	CLIP-seq
MIRT937614	hsa-miR-4699-3p	CLIP-seq
MIRT937615	hsa-miR-4705	CLIP-seq
MIRT1977549	hsa-miR-4720-3p	CLIP-seq
MIRT1977550	hsa-miR-4733-5p	CLIP-seq
MIRT937617	hsa-miR-4773	CLIP-seq
MIRT937618	hsa-miR-4777-5p	CLIP-seq
MIRT937619	hsa-miR-4789-3p	CLIP-seq
MIRT1977551	hsa-miR-4804-3p	CLIP-seq
MIRT937620	hsa-miR-493	CLIP-seq
MIRT937621	hsa-miR-500b	CLIP-seq
MIRT937622	hsa-miR-502-5p	CLIP-seq
MIRT1977552	hsa-miR-508-5p	CLIP-seq
MIRT937623	hsa-miR-509-3-5p	CLIP-seq
MIRT937624	hsa-miR-5095	CLIP-seq
MIRT937625	hsa-miR-509-5p	CLIP-seq
MIRT937628	hsa-miR-513a-5p	CLIP-seq
MIRT937629	hsa-miR-518d-5p	CLIP-seq
MIRT937630	hsa-miR-519a	CLIP-seq
MIRT937631	hsa-miR-519b-3p	CLIP-seq
MIRT937632	hsa-miR-519b-5p	CLIP-seq
MIRT937633	hsa-miR-519c-3p	CLIP-seq
MIRT937634	hsa-miR-519c-5p	CLIP-seq
MIRT937635	hsa-miR-520a-3p	CLIP-seq
MIRT937636	hsa-miR-520b	CLIP-seq
MIRT937637	hsa-miR-520c-3p	CLIP-seq
MIRT937638	hsa-miR-520c-5p	CLIP-seq
MIRT937639	hsa-miR-520d-3p	CLIP-seq
MIRT937640	hsa-miR-520e	CLIP-seq
MIRT937641	hsa-miR-522	CLIP-seq
MIRT937642	hsa-miR-526a	CLIP-seq
MIRT1977553	hsa-miR-543	CLIP-seq
MIRT937643	hsa-miR-548ae	CLIP-seq
MIRT937644	hsa-miR-548aj	CLIP-seq
MIRT937645	hsa-miR-548am	CLIP-seq
MIRT937646	hsa-miR-548b-3p	CLIP-seq
MIRT937649	hsa-miR-548x	CLIP-seq
MIRT937650	hsa-miR-552	CLIP-seq
MIRT1977554	hsa-miR-567	CLIP-seq
MIRT937652	hsa-miR-568	CLIP-seq
MIRT937653	hsa-miR-571	CLIP-seq
MIRT1977555	hsa-miR-578	CLIP-seq
MIRT937654	hsa-miR-579	CLIP-seq
MIRT937655	hsa-miR-580	CLIP-seq
MIRT1977556	hsa-miR-600	CLIP-seq
MIRT1977557	hsa-miR-613	CLIP-seq
MIRT937660	hsa-miR-616	CLIP-seq
MIRT937661	hsa-miR-643	CLIP-seq
MIRT937662	hsa-miR-651	CLIP-seq
MIRT1977558	hsa-miR-654-3p	CLIP-seq
MIRT1977559	hsa-miR-934	CLIP-seq
MIRT937663	hsa-miR-940	CLIP-seq
MIRT937557	hsa-miR-223	CLIP-seq
MIRT937599	hsa-miR-4282	CLIP-seq
MIRT937613	hsa-miR-4697-3p	CLIP-seq
MIRT937654	hsa-miR-579	CLIP-seq
MIRT937574	hsa-miR-331-5p	CLIP-seq
MIRT937582	hsa-miR-362-5p	CLIP-seq
MIRT937600	hsa-miR-4305	CLIP-seq
MIRT937618	hsa-miR-4777-5p	CLIP-seq
MIRT937621	hsa-miR-500b	CLIP-seq
MIRT937622	hsa-miR-502-5p	CLIP-seq
MIRT937629	hsa-miR-518d-5p	CLIP-seq
MIRT937632	hsa-miR-519b-5p	CLIP-seq
MIRT937634	hsa-miR-519c-5p	CLIP-seq
MIRT937638	hsa-miR-520c-5p	CLIP-seq
MIRT937642	hsa-miR-526a	CLIP-seq
MIRT937654	hsa-miR-579	CLIP-seq
MIRT937660	hsa-miR-616	CLIP-seq
MIRT937543	hsa-miR-101	CLIP-seq
MIRT937545	hsa-miR-103b	CLIP-seq
MIRT937546	hsa-miR-1227	CLIP-seq
MIRT937549	hsa-miR-144	CLIP-seq
MIRT937554	hsa-miR-203	CLIP-seq
MIRT937555	hsa-miR-217	CLIP-seq
MIRT937557	hsa-miR-223	CLIP-seq
MIRT937559	hsa-miR-302a	CLIP-seq
MIRT937560	hsa-miR-302b	CLIP-seq
MIRT937561	hsa-miR-302c	CLIP-seq
MIRT937562	hsa-miR-302d	CLIP-seq
MIRT937563	hsa-miR-302e	CLIP-seq
MIRT937564	hsa-miR-3064-3p	CLIP-seq
MIRT937575	hsa-miR-338-5p	CLIP-seq
MIRT937585	hsa-miR-3682-5p	CLIP-seq
MIRT937586	hsa-miR-372	CLIP-seq
MIRT937587	hsa-miR-373	CLIP-seq
MIRT937588	hsa-miR-376a	CLIP-seq
MIRT937589	hsa-miR-376b	CLIP-seq
MIRT937596	hsa-miR-410	CLIP-seq
MIRT937597	hsa-miR-4251	CLIP-seq
MIRT937598	hsa-miR-4277	CLIP-seq
MIRT937602	hsa-miR-4418	CLIP-seq
MIRT937613	hsa-miR-4697-3p	CLIP-seq
MIRT937614	hsa-miR-4699-3p	CLIP-seq
MIRT937615	hsa-miR-4705	CLIP-seq
MIRT937623	hsa-miR-509-3-5p	CLIP-seq
MIRT937624	hsa-miR-5095	CLIP-seq
MIRT937625	hsa-miR-509-5p	CLIP-seq
MIRT937628	hsa-miR-513a-5p	CLIP-seq
MIRT937630	hsa-miR-519a	CLIP-seq
MIRT937631	hsa-miR-519b-3p	CLIP-seq
MIRT937633	hsa-miR-519c-3p	CLIP-seq
MIRT937635	hsa-miR-520a-3p	CLIP-seq
MIRT937636	hsa-miR-520b	CLIP-seq
MIRT937637	hsa-miR-520c-3p	CLIP-seq
MIRT937639	hsa-miR-520d-3p	CLIP-seq
MIRT937640	hsa-miR-520e	CLIP-seq
MIRT937650	hsa-miR-552	CLIP-seq
MIRT937655	hsa-miR-580	CLIP-seq
MIRT937545	hsa-miR-103b	CLIP-seq
MIRT937548	hsa-miR-140-3p	CLIP-seq
MIRT937556	hsa-miR-219-1-3p	CLIP-seq
MIRT937570	hsa-miR-3159	CLIP-seq
MIRT937582	hsa-miR-362-5p	CLIP-seq
MIRT937588	hsa-miR-376a	CLIP-seq
MIRT937589	hsa-miR-376b	CLIP-seq
MIRT937595	hsa-miR-3974	CLIP-seq
MIRT937620	hsa-miR-493	CLIP-seq
MIRT937621	hsa-miR-500b	CLIP-seq
MIRT937652	hsa-miR-568	CLIP-seq
MIRT937653	hsa-miR-571	CLIP-seq
MIRT937661	hsa-miR-643	CLIP-seq
MIRT937662	hsa-miR-651	CLIP-seq
MIRT937545	hsa-miR-103b	CLIP-seq
MIRT937548	hsa-miR-140-3p	CLIP-seq
MIRT937556	hsa-miR-219-1-3p	CLIP-seq
MIRT937570	hsa-miR-3159	CLIP-seq
MIRT937582	hsa-miR-362-5p	CLIP-seq
MIRT937588	hsa-miR-376a	CLIP-seq
MIRT937589	hsa-miR-376b	CLIP-seq
MIRT937595	hsa-miR-3974	CLIP-seq
MIRT937620	hsa-miR-493	CLIP-seq
MIRT937621	hsa-miR-500b	CLIP-seq
MIRT937652	hsa-miR-568	CLIP-seq
MIRT937653	hsa-miR-571	CLIP-seq
MIRT937661	hsa-miR-643	CLIP-seq
MIRT937662	hsa-miR-651	CLIP-seq

Show/Hide all (12)

Transcription factor	Regulation	Reference
ASCL1	Repression	19744316
GATA6	Unknown	21811562
MSC	Unknown	19148141
MSX1	Repression	22455953
MYC	Repression	20697356
MYC	Unknown	17964517
NANOG	Unknown	19148141
POU5F1	Repression	17068183
SOX2	Activation	22015605
TP53	Unknown	15229249
TWIST1	Unknown	18453541
TWIST2	Unknown	18453541

Show/Hide all (80)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	20723538
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	ISS
GO:0000902	Process	Cell morphogenesis	IEA
GO:0001706	Process	Endoderm formation	IEA
GO:0001707	Process	Mesoderm formation	IEA
GO:0001942	Process	Hair follicle development	IEA
GO:0002090	Process	Regulation of receptor internalization	IDA	17804805
GO:0003129	Process	Heart induction	IEA
GO:0003129	Process	Heart induction	ISS
GO:0003170	Process	Heart valve development	ISS
GO:0003197	Process	Endocardial cushion development	ISS
GO:0005515	Function	Protein binding	IPI	11448771, 16189514, 17804805, 19060904, 21944579, 21984209, 27524201, 28514442, 31515488, 33961781
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	11448771, 11742004
GO:0005886	Component	Plasma membrane	IDA	16263759
GO:0007492	Process	Endoderm development	IEA
GO:0007611	Process	Learning or memory	IEA
GO:0007611	Process	Learning or memory	ISS
GO:0008083	Function	Growth factor activity	TAS	10383463
GO:0010628	Process	Positive regulation of gene expression	IEA
GO:0010628	Process	Positive regulation of gene expression	IGI	23164821
GO:0010628	Process	Positive regulation of gene expression	ISS
GO:0010977	Process	Negative regulation of neuron projection development	IEA
GO:0016055	Process	Wnt signaling pathway	IEA
GO:0016055	Process	Wnt signaling pathway	IEA
GO:0030111	Process	Regulation of Wnt signaling pathway	IEA
GO:0030178	Process	Negative regulation of Wnt signaling pathway	IDA	15020244, 22615920
GO:0030178	Process	Negative regulation of Wnt signaling pathway	IEA
GO:0030178	Process	Negative regulation of Wnt signaling pathway	IEA
GO:0030279	Process	Negative regulation of ossification	IEA
GO:0030279	Process	Negative regulation of ossification	ISS
GO:0030326	Process	Embryonic limb morphogenesis	IEA
GO:0030514	Process	Negative regulation of BMP signaling pathway	IEA
GO:0030900	Process	Forebrain development	IEA
GO:0031901	Component	Early endosome membrane	TAS
GO:0032526	Process	Response to retinoic acid	IEA
GO:0039706	Function	Co-receptor binding	IBA
GO:0039706	Function	Co-receptor binding	IPI	11433302, 20093360
GO:0039706	Function	Co-receptor binding	TAS	22988876
GO:0042662	Process	Negative regulation of mesodermal cell fate specification	IDA	20559569
GO:0042663	Process	Regulation of endodermal cell fate specification	IDA	20559569
GO:0043066	Process	Negative regulation of apoptotic process	IEA
GO:0043066	Process	Negative regulation of apoptotic process	ISS
GO:0043523	Process	Regulation of neuron apoptotic process	ISS
GO:0043523	Process	Regulation of neuron apoptotic process	TAS	23164821
GO:0045813	Process	Positive regulation of Wnt signaling pathway, calcium modulating pathway	TAS	23164821
GO:0046330	Process	Positive regulation of JNK cascade	IDA	23164821
GO:0048019	Function	Receptor antagonist activity	IBA
GO:0048019	Function	Receptor antagonist activity	IDA	20723538
GO:0050750	Function	Low-density lipoprotein particle receptor binding	IDA	16263759
GO:0050807	Process	Regulation of synapse organization	IEA
GO:0051966	Process	Regulation of synaptic transmission, glutamatergic	IEA
GO:0060070	Process	Canonical Wnt signaling pathway	IEA
GO:0060173	Process	Limb development	IEA
GO:0060173	Process	Limb development	ISS
GO:0060323	Process	Head morphogenesis	IEA
GO:0060325	Process	Face morphogenesis	IEA
GO:0060392	Process	Negative regulation of SMAD protein signal transduction	IDA	20559569
GO:0061743	Process	Motor learning	IEA
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	IBA
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	IDA	11433302, 11448771, 11742004, 12857724, 17804805, 18044981, 20039315, 20093360, 20559569, 20723538, 22902902
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	IEA
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	IGI	18166153
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	IGI	27846906
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	ISS
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	NAS	24431302
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	TAS	23164821, 24449494
GO:0090244	Process	Wnt signaling pathway involved in somitogenesis	IEA
GO:0098883	Process	Synapse pruning	TAS	24449494
GO:1904338	Process	Regulation of dopaminergic neuron differentiation	TAS	24431302
GO:1904723	Process	Negative regulation of Wnt-Frizzled-LRP5/6 complex assembly	IDA	11448771, 20093360
GO:1904723	Process	Negative regulation of Wnt-Frizzled-LRP5/6 complex assembly	IPI	11433302
GO:1904723	Process	Negative regulation of Wnt-Frizzled-LRP5/6 complex assembly	TAS	23164821
GO:1904958	Process	Positive regulation of midbrain dopaminergic neuron differentiation	IEA
GO:1905607	Process	Negative regulation of presynapse assembly	IEA
GO:2000096	Process	Positive regulation of Wnt signaling pathway, planar cell polarity pathway	TAS	23164821
GO:2000726	Process	Negative regulation of cardiac muscle cell differentiation	IDA	20559569

MIM	HGNC	e!Ensembl
605189	2891	ENSG00000107984

O94907

Protein name

Dickkopf-related protein 1 (Dickkopf-1) (Dkk-1) (hDkk-1) (SK)

Protein function

Antagonizes canonical Wnt signaling by inhibiting LRP5/6 interaction with Wnt and by forming a ternary complex with the transmembrane protein KREMEN that promotes internalization of LRP5/6 (PubMed:22000856). DKKs play an important role in verteb

PDB

3S2K , 3S8V , 3SOQ , 5FWW , 5GJE

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF04706	Dickkopf_N	84 → 139	Dickkopf N-terminal cysteine-rich region	Family

Tissue specificity

TISSUE SPECIFICITY: Placenta.

Sequence

MMALGAAGATRVFVAMVAAALGGHPLLGVSATLNSVLNSNAIKNLPPPLGGAAGHPGSAV
SAAPGILYPGGNKYQTIDNYQPYPCAEDEECGTDEYCASPTRGGDAGVQICLACRKRRKR
CMRHAMCCPGNYCKNGICVSSDQNHFRGEIEETITESFGNDHSTLDGYSRRTTLSSKMYH
TKGQEGSVCLRSSDCASGLCCARHFWSKICKPVLKEGQVCTKHRRKGSHGLEIFQRCYCG
EGLSCRIQKDHHQASNSSRLHTCQRH

Sequence length

266

Interactions

View interactions

	KEGG		Reactome
	Wnt signaling pathway Alzheimer disease Pathways of neurodegeneration - multiple diseases		Negative regulation of TCF-dependent signaling by WNT ligand antagonists Misspliced LRP5 mutants have enhanced beta-catenin-dependent signaling

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (11)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
AUTOIMMUNE THROMBOCYTOPENIC PURPURA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEVELOPMENTAL ABSENCE OF TOOTH	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DKK1-related disorder	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIOSIS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IDIOPATHIC JUVENILE OSTEOPOROSIS	—	Orphanet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonpapillary renal cell carcinoma	Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PERIODONTITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (396)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute Coronary Syndrome	Coronary Syndrome	BEFREE	30580572		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute monocytic leukemia	Monocytic Leukemia	BEFREE	31842997		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	17686056		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	19711349, 26297437		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma Of Esophagus	Esophageal Cancer	BEFREE	30906632		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	28350100, 30470570, 30613269, 31027730		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of pancreas	Pancreatic adenocarcinoma	BEFREE	19711349		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Multiple polyposis syndrome	BEFREE	28708837		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	17329407		★★★★★ ★☆☆☆☆ Found in Text Mining only
Age related macular degeneration	Age-related macular degeneration	BEFREE	28455497		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alkaptonuria	Alkaptonuria	BEFREE	30343446		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alopecia	Alopecia	BEFREE	16730481, 28849028, 30640755		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alopecia Areata	Alopecia Areata	BEFREE	30640755		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alopecia, Male Pattern	Alopecia, Male Pattern	BEFREE	17657240, 22358062, 30640755		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	32831200, 35962130	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer disease, familial, type 3	Alzheimer disease	BEFREE	24449494		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease, Late Onset	Alzheimer disease	BEFREE	18163421		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	30090055, 30232325		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic lateral sclerosis	Pubtator	25811776	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Androgenetic Alopecia	Androgenetic Alopecia	BEFREE	17657240, 30640755		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ankylosing spondylitis	Ankylosing Spondylitis	BEFREE	24593209, 27369645, 27670695, 28153008, 28261616, 28303752, 28816988, 28934972, 29145150, 29544750, 29995219, 30443790, 31538414, 31656088		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anodontia	Anodontia	Pubtator	28813618	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	28749252, 30013637, 30452897, 30610103		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anus, Imperforate	Imperforate anus	BEFREE	25319845		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	29548910		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	29548910		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Valve Insufficiency	Aortic Valve Insufficiency	BEFREE	30227689		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Valve Stenosis	Aortic Valve Sclerosis	BEFREE	23316316		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arnold-Chiari Malformation, Type I	Arnold-Chiari malformation	BEFREE	28513615		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arnold-Chiari Malformation, Type I	Arnold-Chiari malformation	ORPHANET_DG	28513615		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arnold-Chiari Malformation, Type I	Arnold-Chiari malformation	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	26607269, 28703797, 30420710, 31706805		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	Pubtator	23079210, 23595579, 32068606	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	25941031, 27670695, 28934972, 30412852, 30779862		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	37834418	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	25837853, 26350950, 26782930, 26785768, 30157923, 30171335, 30880318, 31019537, 32068606, 39337398	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis, Psoriatic	Psoriatic Arthritis	BEFREE	28634697, 30418122		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthropathy	Arthropathy	BEFREE	27937051, 29194852		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	26872695		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	26607269, 28703797, 30420710, 31706805		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	38175715, 40731833	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autosomal dominant hypophosphatemic rickets	Hypophosphatemic Rickets	BEFREE	23403405		★★★★★ ★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	LHGDN	16863544		★★★★★ ★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	Pubtator	19309775, 26297437	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	BEFREE	26297437		★★★★★ ★☆☆☆☆ Found in Text Mining only
Basilar invagination	Basilar invagination	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet disease	Pubtator	33393726	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	30116403		★★★★★ ★☆☆☆☆ Found in Text Mining only
Biliary Tract Neoplasms	Biliary tract neoplasms	Pubtator	35121803	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	26782465		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone disease	Pubtator	14695408, 17129176, 18005268	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone Disease	BEFREE	16293576, 18005268, 18294945, 18331598, 19657367, 21435697, 21856767, 22363428, 23915193, 24054128, 26419509, 26763740, 27766367, 28526959, 29808090 View all (5 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone Disease	LHGDN	17068150, 18294945, 18331598		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone disease	Pubtator	17255354, 18978943, 19657367, 20653953, 20939046, 21856767, 22363428, 23079210, 23281130, 25182503, 25484108, 27310953, 30496210, 31687048, 33420361, 34875817, 35145077, 40226410 View all (3 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone disease	Pubtator	35277659, 36506070	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bone Diseases Metabolic	Bone disease	Pubtator	25484108	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Ischemia	Cerebral Ischemia	BEFREE	16919965		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	LHGDN	11840333		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	15668788		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	29117471	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	17245340, 17726380, 17876334, 18571836, 20847303, 21915302, 22649545, 23861811, 25351982, 26515701, 28178355, 28248066, 28526959, 28892080, 28960204, 30238177, 30941948, 31285694 View all (3 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	CTD_human_DG	18283316		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	17245340, 18283316, 18546262, 20139903, 22649545, 23861811, 24641868, 25116444, 26378045, 30320375, 30570852, 30941948, 33462997, 36788602, 38036593, 40226410 View all (1 more)	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	24770633	Inhibit	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Calcinosis	Calcinosis	Pubtator	22874762	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Calcinosis	Calcinosis	Pubtator	36281932	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cap Myopathy	Cap myopathy	Pubtator	18978943	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	17329407, 20920327, 21811562, 22966878, 23396252, 23922913, 25484078, 27608843, 27723845, 31568519	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	17363569		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Endometrioid	Endometrioid carcinoma	Pubtator	37655078	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	20532728, 25344678, 26414287, 26960688, 27545991, 27723845, 29117471, 30929558, 31568519, 32815653, 36718957	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	24325363, 26256972, 27821026	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	26782465		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of larynx	Laryngeal carcinoma	BEFREE	31269911		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	17245340, 18339843, 19351856, 19839718, 23396252, 24361889, 25901391, 28081731, 28110687, 28943934, 29683727, 29928394		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	19787627	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	28749252	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	34117362	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	35983409	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	35340228	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Basal Cell	Carcinoma	BEFREE	29121993		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	19787627		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	BEFREE	31028181		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	20665672	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	25436422, 31424619		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cartilage Diseases	Cartilage disease	Pubtator	22736200	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	31120770		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	17329407		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	23132676	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	BEFREE	25144498, 27255549		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	Pubtator	25144498, 27255549	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Choriocarcinoma	Choriocarcinoma	LHGDN	17026960		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	28493902, 29603070, 29959497, 31382263, 31687048		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	20618428		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic myeloproliferative disorder	Myeloproliferative disorder	BEFREE	29975001		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	BEFREE	29243300		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	34886821	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	15592505, 16491118, 17449905, 21317455, 22815877, 29164578		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	BEFREE	15592505		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	LHGDN	15592505, 17449905		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	27245242	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Polyps	Colonic polyps	Pubtator	22022386	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	16491118, 19059704, 21304055, 22966878, 25788273, 28229932, 30229808, 30655833, 31830954		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	BEFREE	16491118		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	16491118		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	18461655, 21304055, 22815877, 22966878, 25788273, 29164578, 33795652, 37090726	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital adrenal hyperplasia due to 21 hydroxylase deficiency	Congenital adrenal hyperplasia	BEFREE	23299503, 30343446		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital adrenal hyperplasia due to 21 hydroxylase deficiency	Congenital adrenal hyperplasia	Pubtator	23299503	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital central hypoventilation syndrome	Congenital central hypoventilation syndrome	Pubtator	23299503	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital Dysplasia Of The Hip	Developmental dysplasia of the hip	BEFREE	24926963		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	20549706, 24676838, 31522588, 31768131		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cranial nerve compression	Cranial nerve compression	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Cranial nerve palsies	Cranial Nerve Paralysis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	24250816, 31729323		★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	31729323	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	21435697, 24286177, 27428952, 27580425, 27937051, 28275825, 28953627, 29165387, 29526783, 30903650, 30947534		★★★★★ ★☆☆☆☆ Found in Text Mining only
Deglutition Disorders	Dysphagia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	28388723, 31424619		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	26278788, 28388723, 29857981, 31424619		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	37728820	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	24227537	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	27766367, 28388723, 30343446		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	27766367, 29243300, 30089481, 30547685, 31706805		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	21613219		★★★★★ ★☆☆☆☆ Found in Text Mining only
Distal peripheral sensory neuropathy	Distal peripheral sensory neuropathy	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Donohue Syndrome	Donohue syndrome	Pubtator	20033851	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	30094104, 30452897		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Hyperplasia	Endometrial hyperplasia	Pubtator	37655078	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	31865530, 37655078	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrioma	Endometrioma	CTD_human_DG	21063030		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	CTD_human_DG	21063030		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Endometriosis	Endometriosis	Pubtator	22259059	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	17363569, 21909757		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	17363569, 21909757		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	24391982, 32707495, 33275591, 33541291	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	34117362	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophagitis	Esophagitis	BEFREE	16863544		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophagitis	Esophagitis	LHGDN	16863544		★★★★★ ★☆☆☆☆ Found in Text Mining only
Exudative age-related macular degeneration	Exudative Macular Degeneration	BEFREE	28455497		★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial multiple trichoepitheliomata	Multiple Trichoepithelioma	BEFREE	30906632		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fanconi Anemia	Fanconi Anemia	BEFREE	24469828		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fanconi Anemia	Fanconi anemia	Pubtator	24469828	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
FANCONI ANEMIA, COMPLEMENTATION GROUP A (disorder)	Anemia	BEFREE	24469828		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	29944670		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	27545991		★★★★★ ★☆☆☆☆ Found in Text Mining only
Focal Cortical Dysplasia	Focal cortical dysplasia	Pubtator	40055364	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Folic Acid Deficiency	Folic Acid Deficiency	BEFREE	17320366		★★★★★ ★☆☆☆☆ Found in Text Mining only
Frontotemporal dementia	Frontotemporal dementia	BEFREE	20050968		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastric Adenocarcinoma	Gastric Cancer	BEFREE	30501604, 30593147		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastroesophageal Reflux	Gastroesophageal reflux disease	Pubtator	19309775, 24481601	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastroesophageal reflux disease	Gastroesophageal Reflux Disease	BEFREE	16863544		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Neoplasms	Gastrointestinal neoplasm	Pubtator	18461655	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gaucher Disease	Gaucher disease	Pubtator	33287247	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gaucher Disease	Gaucher disease	Pubtator	36506070	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	Pubtator	27293372	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	19847810, 21029453		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	21029453	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	21029453		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	20920327, 21029453, 24770633		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	20920327, 21029453, 24770633	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glycogen storage disease type II	Glycogen Storage Disease	BEFREE	28455497		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hamartoma	Hamartoma	BEFREE	19165927		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	37039367	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Failure Diastolic	Heart failure	Pubtator	36184749	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemangioma	Hemangioma	BEFREE	25344678		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic neoplasm	Pubtator	24469828	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematopoietic Neoplasms	Hematopoietic Neoplasms	BEFREE	24469828		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemolytic Uremic Syndrome	Hemolytic uremic syndrome	Pubtator	33574979	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemophilia A	Hemophilia	BEFREE	29194852		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis C	Hepatitis c	Pubtator	24947038, 27821026	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatoblastoma	Hepatoblastoma	BEFREE	12649343, 15958610		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatoblastoma	Hepatoblastoma	Pubtator	12649343, 35507738	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	17245340	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Holoprosencephaly	Holoprosencephaly	BEFREE	10965128		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperandrogenism	Hyperandrogenism	Pubtator	21611153	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypercalcemia	Hypercalcemia	BEFREE	29337225		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	23636253		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperostosis Diffuse Idiopathic Skeletal	Diffuse idiopathic skeletal hyperostosis	Pubtator	28153008	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	31133682, 31424619		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperthyroidism	Hyperthyroidism	BEFREE	30689850		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertrophy	Hypertrophy	Pubtator	35946454	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypodontia	Hypodontia	BEFREE	24737523		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypophosphatemic Rickets, X-Linked Dominant	Hypophosphatemic Rickets	BEFREE	23403405		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypopigmentation disorder	Hypopigmentation Disorder	BEFREE	29442138		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypospadias	Hypospadias	BEFREE	25319845		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypothyroidism	Hypothyroidism	BEFREE	30689850		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	24770633, 33420361	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	34853621	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic juvenile osteoporosis	Osteoporosis	Orphanet			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	20650998		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	20650998	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	23164821, 31680933		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	31154418		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral disc disease	Pubtator	33233925	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable Bowel Syndrome	BEFREE	31154418		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	28097491, 30580563		★★★★★ ★☆☆☆☆ Found in Text Mining only
Juvenile osteoporosis	Osteoporosis	ORPHANET_DG	22789636		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	17245340	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Klippel-Feil Syndrome	Klippel Feil syndrome	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Klippel-Trenaunay-Weber Syndrome	Klippel-Trenaunay-Weber Syndrome	BEFREE	29774401		★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	17686056, 28266575		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	20795789, 28440495, 31842997, 34840706	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	17686056, 21765021, 28816238, 31842997		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	21617850, 25487617		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	19303159, 20532728, 21955977, 23266194, 24325363, 24809435, 24878698, 24947038, 25344678, 26414287, 26960688, 27545991, 27723845, 28419472, 28849121 View all (14 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	20532728	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	24947038, 28902891		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	28419472		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	17245340	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	21048943, 21681374, 23396252, 24377567, 36718957	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus	Lupus Erythematosus	BEFREE	21280006		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	34058801	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Discoid	Lupus Erythematosus	BEFREE	21280006		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	21280006, 28373995		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus Nephritis	BEFREE	21280006, 28373995		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus nephritis	Pubtator	24465439	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Vulgaris	Lupus Vulgaris	BEFREE	21280006		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	18461655, 35340228	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	22649545, 23595579, 24391982, 25048826, 25116444, 26782465, 27608843, 28749252	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	23132676	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Fibrous Histiocytoma	Malignant Histiocytoma	BEFREE	17948129		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	24104453, 24770633		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant mesothelioma	Malignant Mesothelioma	BEFREE	29763912		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	17245340, 17726380, 17876334, 18571836, 21915302, 22649545, 23861811, 24008318, 25351982, 26515701, 28178355, 28248066, 28526959, 28892080, 28960204, 30238177, 30941948, 31285694 View all (3 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	CTD_human_DG	18283316		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	30094104, 30452897		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	17363569, 20551066, 21909757		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	17245340, 20549706		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	24878698, 26956539, 29458569		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	17245340, 17363569, 18339843, 19351856, 19839718, 23396252, 24361889, 25901391, 28081731, 28110687, 28943934, 29683727, 29928394		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	21617850		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of oropharynx	Malignant Neoplasm Of Oropharynx	BEFREE	25487617		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	19787627		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	19711349, 21811562, 30580676		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	16140917, 21098705, 21344486, 21435697, 23752183, 26545120, 26913608, 29772510		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	27023747, 29720122		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	23261982		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	26782465		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	15592430, 17245340, 17363569, 20435406, 20551066, 21029453, 21617850, 21811562, 23396252, 24008318, 24377567, 24391982, 24577091, 24878698, 25788273 View all (15 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	15592505, 16491118, 17449905, 21317455, 22815877, 29164578		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Carcinoma, Human	Marfan Syndrome	CTD_human_DG	18283316		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	17245340, 20847303, 30238177		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	17245340, 17485441, 17876334, 18546262, 18571836		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	CTD_human_DG	18283316		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms, Human	Mammary Neoplasms	CTD_human_DG	18283316		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	Pubtator	12649343, 17329407, 20823417, 23567267	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	17329407, 20823417		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	LHGDN	17329407		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	LHGDN	16568085		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
melanoma	Melanoma	BEFREE	17245340, 23028975, 24733089		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Melanoma	Pubtator	24733089, 28067893	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mesothelioma	Mesothelioma	BEFREE	15451431		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Bone Disorder	Metabolic Bone Disorder	BEFREE	21435697		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic syndrome	Pubtator	21611153	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metastatic melanoma	Metastatic Melanoma	BEFREE	28423208		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metastatic Prostate Carcinoma	Metastatic Prostate Carcinoma	BEFREE	30116403		★★★★★ ★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	Pubtator	35546551	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mild cognitive disorder	Cognitive disorder	BEFREE	31680933		★★★★★ ★☆☆☆☆ Found in Text Mining only
Miscarriage	Miscarriage	BEFREE	23600832		★★★★★ ★☆☆☆☆ Found in Text Mining only
Monoclonal Gammopathy of Undetermined Significance	Monoclonal Gammapathies	BEFREE	18331598		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mouth Diseases	Mouth disease	Pubtator	18561248	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	25487617	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	14695408, 15561686, 16293576, 17255354, 18005268, 18294945, 18305214, 18331598, 19657367, 20846389, 21435697, 22082361, 22363428, 23066034, 23915193 View all (11 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	14695408, 17255354, 17344918, 18005268, 19657367, 20438295, 20653953, 20846389, 22363428, 26601950, 30614800, 33420361, 34871540, 35965418	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	LHGDN	16293576, 17068150, 17255354, 17702698, 18305214, 19067746		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	27310953	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy Duchenne	Duchenne muscular dystrophy	Pubtator	18021006	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloproliferative disease	Myeloproliferative disorder	BEFREE	29975001		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	38175715	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myopia	Myopia	BEFREE	24755605		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myopia, Degenerative	Myopia	BEFREE	31335221		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	12649343, 14555616, 15451431, 15592505, 16491118, 17329407, 17363569, 18978943, 19035286, 19351856, 19358268, 19488830, 20435406, 20549706, 20551066 View all (42 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephroblastoma	Nephroblastoma	BEFREE	21472018		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	17643814, 25370481, 31208278		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	24586304	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	33287247	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	16919965, 20050968, 23164821, 31786070		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	LHGDN	16919965		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	30315891		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	19839718, 23396252, 24361889, 24391982, 25901391, 28350100, 28677426, 28790847, 29108326		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nystagmus	Nystagmus	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Oculocutaneous albinism type 1B	Oculocutaneous albinism	Pubtator	28153008	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Oestrogen receptor positive breast cancer	Oestrogen Receptor Positive Breast Cancer	BEFREE	28526959		★★★★★ ★☆☆☆☆ Found in Text Mining only
Oropharyngeal Carcinoma	Oropharyngeal Carcinoma	BEFREE	25487617		★★★★★ ★☆☆☆☆ Found in Text Mining only
Oropharyngeal Neoplasms	Oropharyngeal neoplasm	Pubtator	25487617	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteitis Deformans	Paget disease	BEFREE	21435697, 23836157, 28054306, 31384515		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	19217321, 27428952, 28953627, 29806631, 30903650, 30947534, 32819387	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis Hip	Osteoarthritis	Pubtator	28275825	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis of hip	Osteoarthritis Of Hip	BEFREE	28275825		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis, Knee	Knee osteoarthritis	BEFREE	28451870, 28676900, 30947534		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthropathy Primary Hypertrophic	Primary hypertrophic osteoarthropathy	Pubtator	20042673	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthropathy Primary Hypertrophic	Primary hypertrophic osteoarthropathy	Pubtator	20042673	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthropathy, Primary Hypertrophic	Pachydermoperiostosis syndrome	BEFREE	20042673		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteonecrosis	Osteonecrosis	Pubtator	30551361	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	16730481, 21435697, 26780085, 27580425, 28079119, 29216526, 29617179, 30779862		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	15110782, 21435697, 24138842, 24430505, 26780085, 28628652, 28972408, 29105022, 29194852, 29282619, 29504704, 30280759, 31729834		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	20939046	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	21452281	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	22692843, 23595579, 26930606, 29504704, 30026596, 31197079, 31968132, 33939331, 34034718	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	12740383	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	LHGDN	17987039		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	24577091, 28682874, 29845282		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	32723833	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Carcinoma	Ovarian Carcinoma	BEFREE	19787627		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Failure, Premature	Ovarian Failure	BEFREE	31745224		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	28209618		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	19787627, 21131918	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	33613114	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
OVERLAP CONNECTIVE TISSUE DISEASE	MASS syndrome	BEFREE	17295608, 29105022, 31521827		★★★★★ ★☆☆☆☆ Found in Text Mining only
Paget Disease	Paget disease	BEFREE	21435697		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	19711349, 21811562, 30580676		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	19711349, 28749252, 30452897		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	19744316, 21811562, 26101916, 34117362, 34143198, 34993253, 39487387	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatitis Chronic	Pancreatitis	Pubtator	26101916	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillary craniopharyngioma	Papillary Craniopharyngioma	BEFREE	30232325		★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	23261982, 24848709, 26782539		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parathyroid Neoplasms	Parathyroid Neoplasms	BEFREE	29724878		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	34943986	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Penile hypospadias	Penile Hypospadias	BEFREE	25319845		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peptic Esophagitis	Peptic Esophagitis	BEFREE	24481601		★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	26278788, 30915637		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Periodontitis	Periodontitis	Pubtator	27216891	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pick Disease of the Brain	Pica	BEFREE	20050968		★★★★★ ★☆☆☆☆ Found in Text Mining only
Platybasia	Platybasia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	21611153, 28587752, 31745224		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	21611153, 31745224	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycythemia Vera	Polycythemia Vera	BEFREE	29975001		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polydactyly	Polydactyly	BEFREE	29105022		★★★★★ ★☆☆☆☆ Found in Text Mining only
Posterior fossa compression syndrome	Brain stem compression	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Prader-Willi Syndrome	Prader-Willi Syndrome	BEFREE	30343446		★★★★★ ★☆☆☆☆ Found in Text Mining only
Premature Menopause	Premature Menopause	BEFREE	31745224		★★★★★ ★☆☆☆☆ Found in Text Mining only
Progressive cerebellar ataxia	Cerebellar Ataxia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	16140917, 21098705, 21344486, 21435697, 23752183, 26545120, 26913608, 27310953, 29772510		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Hyperplasia	Prostatic hyperplasia	Pubtator	30116403	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	18478098	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	18561248, 18978943		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	18561248, 25182503, 26913608	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	30116403	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	Pubtator	20376066	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	25228306, 31717649		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Arterial Hypertension	Pulmonary arterial hypertension	Pubtator	37039367	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	35027825	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal carcinoma	Renal Carcinoma	BEFREE	20549706		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	20549706		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal Diseases	BEFREE	24091497		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal detachment	Pubtator	27293372	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	LHGDN	18843784		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	23041840, 23546988, 25941031, 26715774, 27580425, 28151034, 28474138, 28634697, 28993870, 29282619, 29665496, 30157923, 30291470, 30599401, 31019537		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sacroiliitis	Sacroiliitis	BEFREE	26313358		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sacroiliitis	Sacroiliitis	Pubtator	26313358	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma Ewing	Sarcoma	Pubtator	19247449	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	20153141		★★★★★ ★☆☆☆☆ Found in Text Mining only
Scleroderma	Scleroderma	BEFREE	27670695, 30277866		★★★★★ ★☆☆☆☆ Found in Text Mining only
Scoliosis, unspecified	Scoliosis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	34058801	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sleep Apnea, Central	Sleep Apnea	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	28081731, 29731859		★★★★★ ★☆☆☆☆ Found in Text Mining only
Spinal Cord Diseases	Spinal Cord Diseases	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Spondylarthritis	Spondyloarthritis	BEFREE	25941031, 26313358, 28626213, 30206711		★★★★★ ★☆☆☆☆ Found in Text Mining only
Spondylitis Ankylosing	Ankylosing spondylitis	Pubtator	25518021, 26313358, 31656088, 37506134	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Spondylitis Ankylosing	Ankylosing spondylitis	Pubtator	35743102	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	19995224		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	29563607		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	28337453, 33281184, 35361159, 36007290, 36690301, 39282247	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	19995224		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	27023747, 29720122		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	22496615	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	28152305, 29720122, 31868807, 33661721, 34482288, 34746312, 36762306	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	30593147, 31952791	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	30496210	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Synovitis	Synovitis	BEFREE	22736200		★★★★★ ★☆☆☆☆ Found in Text Mining only
Syringomyelia	Syringomyelia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	23698475, 27670695, 30001654, 30277866, 30291470		★★★★★ ★☆☆☆☆ Found in Text Mining only
Temporomandibular Joint Disorders	Temporomandibular Joint Disorders	BEFREE	26239269		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombocythemia, Essential	Thrombocythemia	BEFREE	29975001		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombosis	Thrombosis	Pubtator	23028464	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	23261982		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	23261982		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	22649545		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	22649545	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Tuberous Sclerosis	Tuberous Sclerosis	BEFREE	19351856		★★★★★ ★☆☆☆☆ Found in Text Mining only
Turner Syndrome	Turner syndrome	Pubtator	35237949	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	26782465	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Dysplasia	Uterine disease	Pubtator	23595579	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	23595579	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Diseases	Uterine polyp	Pubtator	19328470	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Van Buchem disease	Van Buchem Disease	BEFREE	18538647		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Calcification	Vascular calcification	Pubtator	37179214, 37728820, 40731833	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	37039367	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ventricular Remodeling	Ventricular remodeling	Pubtator	37039367	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vitamin D-Resistant Rickets, X-Linked	Vitamin D-Dependent Rickets	BEFREE	23403405		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	BEFREE	29442138, 29605863		★★★★★ ★☆☆☆☆ Found in Text Mining only
VITILIGO-ASSOCIATED MULTIPLE AUTOIMMUNE DISEASE SUSCEPTIBILITY 1 (finding)	Vitiligo-associated SYSTEMIC LUPUS ERYTHEMATOSUS	BEFREE	29442138, 29605863		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vocal Cord Paralysis	Vocal Cord Paralysis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Wilms Tumor	Wilms tumor	Pubtator	12649343	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

DKK1 (dickkopf Wnt signaling pathway inhibitor 1)