SIRT2 (sirtuin 2)

Gene

• Entrez ID: 22933
• Gene name: Sirtuin 2
• Gene symbol: SIRT2
• Synonyms (NCBI Gene): SIR2, SIR2L, SIR2L2
• Chromosome: 19
• Chromosome location: 19q13.2
• Summary: This gene encodes a member of the sirtuin family of proteins, homologs to the yeast Sir2 protein. Members of the sirtuin family are characterized by a sirtuin core domain and grouped into four classes. The functions of human sirtuins have not yet been det

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT025871	hsa-miR-7-5p	Sequencing	20371350
MIRT438487	hsa-miR-21-5p	Western blot	24161395
MIRT438487	hsa-miR-21-5p	Western blot	24161395
MIRT025871	hsa-miR-7-5p	Luciferase reporter assay	27158385
MIRT025871	hsa-miR-7-5p	Luciferase reporter assay	27158385
MIRT734726	hsa-miR-339-5p	Luciferase reporter assay, Western blotting, Immunofluorescence, qRT-PCR, ELISA	33849089
MIRT736562	hsa-miR-212-5p	Luciferase reporter assay, Western blotting, qRT-PCR	34117507
MIRT756390	hsa-miR-106b-5p	Luciferase reporter assay, Western blotting	36308623
MIRT1350139	hsa-miR-323b-3p	CLIP-seq
MIRT1350140	hsa-miR-3908	CLIP-seq
MIRT1350141	hsa-miR-4775	CLIP-seq
MIRT1350142	hsa-miR-515-5p	CLIP-seq
MIRT1350143	hsa-miR-1275	CLIP-seq
MIRT1350144	hsa-miR-1303	CLIP-seq
MIRT1350145	hsa-miR-3152-3p	CLIP-seq
MIRT1350146	hsa-miR-3170	CLIP-seq
MIRT1350147	hsa-miR-3689d	CLIP-seq
MIRT1350148	hsa-miR-4266	CLIP-seq
MIRT1350149	hsa-miR-4488	CLIP-seq
MIRT1350150	hsa-miR-4503	CLIP-seq
MIRT1350151	hsa-miR-4665-5p	CLIP-seq
MIRT1350152	hsa-miR-4694-5p	CLIP-seq
MIRT1350153	hsa-miR-4695-5p	CLIP-seq
MIRT1350154	hsa-miR-4697-5p	CLIP-seq
MIRT1350155	hsa-miR-4708-5p	CLIP-seq
MIRT1350156	hsa-miR-4731-5p	CLIP-seq
MIRT1350157	hsa-miR-4757-5p	CLIP-seq
MIRT1350158	hsa-miR-4779	CLIP-seq
MIRT1350144	hsa-miR-1303	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
ATF4	Repression	21801305
DDIT3	Repression	21801305

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	18722353
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IMP	24681946
GO:0000183	Process	RDNA heterochromatin formation	IBA
GO:0000183	Process	RDNA heterochromatin formation	NAS	11427894
GO:0000781	Component	Chromosome, telomeric region	IEA
GO:0000792	Component	Heterochromatin	ISS
GO:0002376	Process	Immune system process	IEA
GO:0003682	Function	Chromatin binding	IDA	23908241
GO:0003950	Function	NAD+ poly-ADP-ribosyltransferase activity	IDA	10381378
GO:0003950	Function	NAD+ poly-ADP-ribosyltransferase activity	TAS	17456799
GO:0004407	Function	Histone deacetylase activity	IDA	17488717
GO:0004407	Function	Histone deacetylase activity	IEA
GO:0005515	Function	Protein binding	IPI	12697818, 12887892, 15213244, 17172643, 17726514, 18722353, 20543840, 21081649, 21653829, 21949390, 22014574, 23932781, 24681946, 24769394, 24825348, 27512957
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	15213244, 16648462, 17726514, 23908241, 24177535
GO:0005634	Component	Nucleus	IEA
GO:0005677	Component	Chromatin silencing complex	NAS	12697818
GO:0005694	Component	Chromosome	IDA	16648462
GO:0005694	Component	Chromosome	IEA
GO:0005730	Component	Nucleolus	IDA
GO:0005737	Component	Cytoplasm	IDA	12697818, 15213244, 16079181, 16648462, 17726514, 20543840, 23908241, 24177535
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IEA
GO:0005813	Component	Centrosome	IDA	17488717, 17726514
GO:0005813	Component	Centrosome	IEA
GO:0005814	Component	Centriole	IDA	17726514
GO:0005814	Component	Centriole	IEA
GO:0005819	Component	Spindle	IDA	17726514
GO:0005819	Component	Spindle	IEA
GO:0005829	Component	Cytosol	IDA	24681946
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IEA
GO:0005874	Component	Microtubule	IDA	12620231
GO:0005874	Component	Microtubule	IEA
GO:0005886	Component	Plasma membrane	IDA
GO:0005886	Component	Plasma membrane	IEA
GO:0006325	Process	Chromatin organization	IEA
GO:0006476	Process	Protein deacetylation	IDA	24177535
GO:0006476	Process	Protein deacetylation	IDA	20543840, 21949390, 24177535
GO:0006511	Process	Ubiquitin-dependent protein catabolic process	IDA	23932781
GO:0006633	Process	Fatty acid biosynthetic process	IDA	10653665, 19286649
GO:0006914	Process	Autophagy	IEA
GO:0007084	Process	Mitotic nuclear membrane reassembly	TAS
GO:0007096	Process	Regulation of exit from mitosis	NAS	12697818
GO:0007399	Process	Nervous system development	IEA
GO:0008270	Function	Zinc ion binding	IDA	11427894
GO:0010507	Process	Negative regulation of autophagy	IMP	20543840
GO:0010801	Process	Negative regulation of peptidyl-threonine phosphorylation	ISS
GO:0014816	Process	Skeletal muscle satellite cell differentiation	ISS
GO:0016020	Component	Membrane	IEA
GO:0016042	Process	Lipid catabolic process	IEA
GO:0016042	Process	Lipid catabolic process	ISS
GO:0016740	Function	Transferase activity	IEA
GO:0017136	Function	Histone deacetylase activity, NAD-dependent	IBA
GO:0017136	Function	Histone deacetylase activity, NAD-dependent	IDA	24177535
GO:0017136	Function	Histone deacetylase activity, NAD-dependent	IDA	11427894, 12697818, 24177535
GO:0017136	Function	Histone deacetylase activity, NAD-dependent	IEA
GO:0021762	Process	Substantia nigra development	HEP	22926577
GO:0022011	Process	Myelination in peripheral nervous system	IEA
GO:0022011	Process	Myelination in peripheral nervous system	ISS
GO:0030154	Process	Cell differentiation	IEA
GO:0030426	Component	Growth cone	IEA
GO:0030496	Component	Midbody	IDA	17726514
GO:0030496	Component	Midbody	IEA
GO:0031507	Process	Heterochromatin formation	NAS	12697818
GO:0031509	Process	Subtelomeric heterochromatin formation	NAS	11427894
GO:0031641	Process	Regulation of myelination	IEA
GO:0031641	Process	Regulation of myelination	ISS
GO:0032436	Process	Positive regulation of proteasomal ubiquitin-dependent protein catabolic process	IEA
GO:0032436	Process	Positive regulation of proteasomal ubiquitin-dependent protein catabolic process	IMP	24681946
GO:0032436	Process	Positive regulation of proteasomal ubiquitin-dependent protein catabolic process	ISS
GO:0033010	Component	Paranodal junction	IEA
GO:0033010	Component	Paranodal junction	ISS
GO:0033270	Component	Paranode region of axon	ISS
GO:0033558	Function	Protein lysine deacetylase activity	IDA	17172643, 20543840
GO:0033558	Function	Protein lysine deacetylase activity	IEA
GO:0033558	Function	Protein lysine deacetylase activity	IMP	23908241
GO:0034599	Process	Cellular response to oxidative stress	IEA
GO:0034599	Process	Cellular response to oxidative stress	ISS
GO:0034979	Function	NAD-dependent protein lysine deacetylase activity	IDA	18722353, 21949390, 23932781
GO:0034979	Function	NAD-dependent protein lysine deacetylase activity	IEA
GO:0034979	Function	NAD-dependent protein lysine deacetylase activity	IMP	24681946
GO:0034979	Function	NAD-dependent protein lysine deacetylase activity	TAS
GO:0034983	Process	Peptidyl-lysine deacetylation	IDA	23932781
GO:0035035	Function	Histone acetyltransferase binding	IPI	12887892
GO:0040029	Process	Epigenetic regulation of gene expression	IEA
GO:0040029	Process	Epigenetic regulation of gene expression	IMP	23908241
GO:0042177	Process	Negative regulation of protein catabolic process	IMP	20543840
GO:0042325	Process	Regulation of phosphorylation	NAS	12697818
GO:0042826	Function	Histone deacetylase binding	IPI	12620231
GO:0042903	Function	Tubulin deacetylase activity	IDA	24177535
GO:0042903	Function	Tubulin deacetylase activity	IDA	12620231, 18722353, 23886946, 24177535
GO:0042903	Function	Tubulin deacetylase activity	IEA
GO:0042995	Component	Cell projection	IEA
GO:0043130	Function	Ubiquitin binding	IDA	12697818
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IEA
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IMP	21841822
GO:0043204	Component	Perikaryon	IEA
GO:0043204	Component	Perikaryon	ISS
GO:0043209	Component	Myelin sheath	IEA
GO:0043209	Component	Myelin sheath	ISS
GO:0043219	Component	Lateral loop	ISS
GO:0043220	Component	Schmidt-Lanterman incisure	IEA
GO:0043220	Component	Schmidt-Lanterman incisure	ISS
GO:0043388	Process	Positive regulation of DNA binding	ISS
GO:0043687	Process	Post-translational protein modification	IEA
GO:0044224	Component	Juxtaparanode region of axon	ISS
GO:0044546	Process	NLRP3 inflammasome complex assembly	IEA
GO:0045087	Process	Innate immune response	IEA
GO:0045598	Process	Regulation of fat cell differentiation	IEA
GO:0045599	Process	Negative regulation of fat cell differentiation	IEA
GO:0045599	Process	Negative regulation of fat cell differentiation	ISS
GO:0045717	Process	Negative regulation of fatty acid biosynthetic process	IDA	23932781
GO:0045723	Process	Positive regulation of fatty acid biosynthetic process	IDA	23932781
GO:0045836	Process	Positive regulation of meiotic nuclear division	IEA
GO:0045836	Process	Positive regulation of meiotic nuclear division	ISS
GO:0045843	Process	Negative regulation of striated muscle tissue development	IDA	12887892
GO:0045892	Process	Negative regulation of DNA-templated transcription	IDA	12887892
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	ISS
GO:0046872	Function	Metal ion binding	IEA
GO:0046890	Process	Regulation of lipid biosynthetic process	IEA
GO:0046970	Function	Histone H4K16 deacetylase activity, NAD-dependent	IDA	16648462
GO:0046970	Function	Histone H4K16 deacetylase activity, NAD-dependent	IEA
GO:0048471	Component	Perinuclear region of cytoplasm	IEA
GO:0048471	Component	Perinuclear region of cytoplasm	ISS
GO:0051093	Process	Negative regulation of developmental process	IEA
GO:0051239	Process	Regulation of multicellular organismal process	IEA
GO:0051287	Function	NAD binding	IEA
GO:0051301	Process	Cell division	IEA
GO:0051321	Process	Meiotic cell cycle	IEA
GO:0051726	Process	Regulation of cell cycle	IMP	17726514
GO:0051775	Process	Response to redox state	NAS	12887892
GO:0051781	Process	Positive regulation of cell division	IEA
GO:0051781	Process	Positive regulation of cell division	ISS
GO:0051987	Process	Positive regulation of attachment of spindle microtubules to kinetochore	IEA
GO:0051987	Process	Positive regulation of attachment of spindle microtubules to kinetochore	ISS
GO:0061433	Process	Cellular response to caloric restriction	IEA
GO:0061433	Process	Cellular response to caloric restriction	ISS
GO:0062013	Process	Positive regulation of small molecule metabolic process	IEA
GO:0070403	Function	NAD+ binding	IDA	11427894
GO:0070403	Function	NAD+ binding	IEA
GO:0070446	Process	Negative regulation of oligodendrocyte progenitor proliferation	ISS
GO:0071456	Process	Cellular response to hypoxia	IDA	24681946
GO:0071456	Process	Cellular response to hypoxia	IEA
GO:0071872	Process	Cellular response to epinephrine stimulus	IEA
GO:0071872	Process	Cellular response to epinephrine stimulus	ISS
GO:0072686	Component	Mitotic spindle	IDA	17488717
GO:0072687	Component	Meiotic spindle	IEA
GO:0072687	Component	Meiotic spindle	ISS
GO:0090042	Process	Tubulin deacetylation	IDA	24177535
GO:0090042	Process	Tubulin deacetylation	IDA	18722353, 24177535
GO:0090042	Process	Tubulin deacetylation	ISS
GO:0097386	Component	Glial cell projection	ISS
GO:0140297	Function	DNA-binding transcription factor binding	IPI	12887892, 15126506
GO:0140773	Function	NAD-dependent protein demyristoylase activity	IDA	25704306, 32103017
GO:0140773	Function	NAD-dependent protein demyristoylase activity	IEA
GO:0140774	Function	NAD-dependent protein depalmitoylase activity	IDA	32103017
GO:0140774	Function	NAD-dependent protein depalmitoylase activity	IEA
GO:1900119	Process	Positive regulation of execution phase of apoptosis	IEA
GO:1900119	Process	Positive regulation of execution phase of apoptosis	ISS
GO:1900195	Process	Positive regulation of oocyte maturation	IEA
GO:1900195	Process	Positive regulation of oocyte maturation	ISS
GO:1900226	Process	Negative regulation of NLRP3 inflammasome complex assembly	IEA
GO:1902725	Process	Negative regulation of satellite cell differentiation	ISS
GO:1990404	Function	NAD+-protein mono-ADP-ribosyltransferase activity	TAS	17456799
GO:2000378	Process	Negative regulation of reactive oxygen species metabolic process	IEA
GO:2000378	Process	Negative regulation of reactive oxygen species metabolic process	ISS

Other IDs

• MIM: 604480
• HGNC: 10886
• e!Ensembl: ENSG00000068903

Protein

• UniProt ID: Q8IXJ6
• Protein name: NAD-dependent protein deacetylase sirtuin-2 (EC 2.3.1.286) (NAD-dependent protein defatty-acylase sirtuin-2) (EC 2.3.1.-) (Regulatory protein SIR2 homolog 2) (SIR2-like protein 2)
• Protein function: NAD-dependent protein deacetylase, which deacetylates internal lysines on histone and alpha-tubulin as well as many other proteins such as key transcription factors (PubMed:12620231, PubMed:16648462, PubMed:18249187, PubMed:18332217, PubMed:1899
• PDB: 1J8F, 3ZGO, 3ZGV, 4L3O, 4R8M, 4RMG, 4RMH, 4RMI, 4RMJ, 4X3O, 4X3P, 4Y6L, 4Y6O, 4Y6Q, 5D7O, 5D7P, 5D7Q, 5DY4, 5DY5, 5FYQ, 5G4C, 5MAR, 5MAT, 5Y0Z, 5Y5N, 5YQL, 5YQM, 5YQN, 5YQO, 6L65, 6L66, 6L71, 6L72, 6NR0, 6QCN, 7BOS, 7BOT, 8OWZ, 8PY3, 8QOO, 8QT0, 8QT1, 8QT2, 8QT3, 8QT4, 8QT8, 8QTU, 8TGP, 8XE7
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF02146	SIR2	84 → 268	Sir2 family	Family

• Tissue specificity: TISSUE SPECIFICITY: Isoform 1 is expressed in heart, liver and skeletal muscle, weakly expressed in the cortex. Isoform 2 is strongly expressed in the cortex, weakly expressed in heart and liver. Weakly expressed in several malignancies including breast,
• Sequence:

  MAEPDPSHPLETQAGKVQEAQDSDSDSEGGAAGGEADMDFLRNLFSQTLSLGSQKERLLD
  ELTLEGVARYMQSERCRRVICLVGAGISTSAGIPDFRSPSTGLYDNLEKYHLPYPEAIFE
  ISYFKKHPEPFFALAKELYPGQFKPTICHYFMRLLKDKGLLLRCYTQNIDTLERIAGLEQ
  EDLVEAHGTFYTSHCVSASCRHEYPLSWMKEKIFSEVTPKCEDCQSLVKPDIVFFGESLP
  ARFFSCMQSDFLKVDLLLVMGTSLQVQPFASLISKAPLSTPRLLINKEKAGQSDPFLGMI
  MGLGGGMDFDSKKAYRDVAWLGECDQGCLALAELLGWKKELEDLVRREHASIDAQSGAGV
  PNPSTSASPKKSPPPAKDEARTTEREKPQ

• Sequence length: 389

Pathways

KEGG:

Nicotinate and nicotinamide metabolism
Metabolic pathways

Reactome:

Initiation of Nuclear Envelope (NE) Reformation

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
Acute myeloid leukemia	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholangiocarcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colon adenocarcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DISTURBANCE IN MOOD	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOOD DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonpapillary renal cell carcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thymoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine carcinosarcoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma	Adenocarcinoma	BEFREE	31656671		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	30871086	Associate	★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	34440700	Stimulate	★☆☆☆☆ Found in Text Mining only
Alzheimer Disease, Late Onset	Alzheimer disease	BEFREE	24139700		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	22796962, 31812544		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic lateral sclerosis	Pubtator	40306441	Associate	★☆☆☆☆ Found in Text Mining only
Anhedonia	Anhedonia	BEFREE	28778545		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	30483753		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	29355701		★☆☆☆☆ Found in Text Mining only
Arthritis Juvenile	Juvenile arthritis	Pubtator	34963488	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	34344401	Stimulate	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	31542484		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	30483753		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	22089141		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	28845527, 31087297, 31418154		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	23340254, 24457910, 27725455, 33789098, 35408848	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	23800187, 28259910, 28461331, 30081901	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	28461331	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	12007281		★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	26631040	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	30111572, 32493816, 35688384, 36308411	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	22089141		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	25915617, 29901178		★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	26121130	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	37096064	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Basal Cell	Carcinoma	BEFREE	26631040		★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	28259910		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	25766107		★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	27796760, 31651707		★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	27796760		★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	25794641		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervix carcinoma	Cervix carcinoma	BEFREE	25794641		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	30933885		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	26794150		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	20562129		★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	27125275		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	25312940, 29706374		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	28088387, 28514749, 30584257, 30986062		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	28514749, 32141187, 33450304, 35264593	Associate	★☆☆☆☆ Found in Text Mining only
Congenital chromosomal disease	Congenital Chromosomal Disease	BEFREE	23468428		★☆☆☆☆ Found in Text Mining only
Congenital contractural arachnodactyly	Congenital Contractural Arachnodactyly	BEFREE	30933885		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	30261494		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	28445509	Associate	★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	29706374		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	23276927		★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	Pubtator	28600779	Associate	★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	BEFREE	31471557		★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	23712749, 28185898, 28778545, 29158185, 30482390, 31495082		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	17901049, 25766107, 28127057, 31153040		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	17901049, 25766107, 28127057, 31153040		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	32271403	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	32438712, 37062555, 39788488	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	30981502		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	21331741, 23276927, 28973648, 29296001, 29371109		★☆☆☆☆ Found in Text Mining only
Diabetic Foot	Diabetic foot	Pubtator	33096729	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	39788488	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic retinopathy	Pubtator	38336992	Associate	★☆☆☆☆ Found in Text Mining only
Disturbance in mood	Mood Disorder	BEFREE	23712749		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Disturbance in mood	Mood Disorder	PSYGENET_DG	23712749		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	26701732		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	26701732, 37723477	Associate	★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	33327875	Stimulate	★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	31197036		★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	27125275, 30111572		★☆☆☆☆ Found in Text Mining only
Gastritis	Gastritis	BEFREE	29355701		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	30213795		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	34359896	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	30213795		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	12963026, 16909107, 24161395		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	LHGDN	12963026, 16909107		★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	18762557, 21513696, 23417962, 24436303, 27796760, 29654491, 30019499		★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	30102915		★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	30483753		★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	31471557, 31713761		★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Intellectual developmental disorder	Pubtator	28600779	Associate	★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral Disc Degeneration	BEFREE	31238070		★☆☆☆☆ Found in Text Mining only
Intervertebral disc disorder	Intervertebral Disc Disorder	BEFREE	30981502		★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	23201684, 27796760, 29654491		★☆☆☆☆ Found in Text Mining only
Ischemic Stroke	Ischemic stroke	Pubtator	33616302	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	39788488	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	22207684, 28053092, 30081901	Associate	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	29685974		★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid	Myeloid leukemia	Pubtator	22207684	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	22207684, 27291931, 30081901	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	26647771, 27586085		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	22014574, 28992545, 30111572, 30955067		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	27125275		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	37777567	Inhibit	★☆☆☆☆ Found in Text Mining only
Liver Failure, Acute	Liver failure	BEFREE	31129140		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	25915617, 36453571	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	26942878	Inhibit	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	28166441	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	32176025	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma, T-Cell, Cutaneous	Lymphoma	BEFREE	24343700		★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	29158185		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	22014574, 28845527, 31087297, 31418154		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	26701732		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gastrointestinal tract	Malignant gastrointestinal tract tumors	BEFREE	29706374		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	25915617, 29901178, 29957526		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	28259910		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	29706374		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	29262808		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of skin	Skin cancer	BEFREE	24438005		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	29088792, 29693338, 29925042		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	22089141		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	12494881, 16211212, 19017485, 23723075, 24379401, 25312940, 25486244, 25766107, 25794641, 28240897, 28259910, 28301150, 28415012, 28461331, 28989670, 29262808, 29685974, 29908203, 29957526, 30081901, 30114477, 30261494, 30482390, 30734528, 30986062, 31074370, 31087297, 31357491, 31373792		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	25794641		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	25312940, 29706374		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	24183459		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	16247014, 28166441, 28882678, 34068624	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
melanoma	Melanoma	BEFREE	28166441, 28882678, 31091806		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental Depression	Mental Depression	BEFREE	23712749, 28185898, 28778545, 29158185, 30482390, 31495082		★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	30512225		★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood Disorder	BEFREE	23712749, 29802856, 31495082		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mood Disorders	Mood Disorder	PSYGENET_DG	23712749		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Myeloma	Multiple myeloma	Pubtator	34476507, 35669651	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	31812544		★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy, Oculopharyngeal	Oculopharyngeal Muscular Dystrophy	BEFREE	18397876		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	23201684		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	28445509	Associate	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	31727006		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	12963026, 16211212, 22014574, 23468428, 23915912, 24183459, 24438005, 24814870, 25915617, 27637077, 28088387, 28166441, 28259910, 28461331, 29262808, 29908203, 30067423, 30092626, 30261494, 30584257, 30789810, 30835165, 31418154		★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	29654491, 31713761		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	23175188	Associate	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	27875273, 30081901	Associate	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	23417962, 24946089, 25312940, 28257421, 28299833, 28301150, 28634568, 28984064, 28989670, 29102593, 31373792, 31505260, 31812544		★☆☆☆☆ Found in Text Mining only
Neurofibromatosis 2	Neurofibromatosis	BEFREE	24259290		★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	28970254, 31197036		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	23915912, 24379401, 25719312, 25915617, 26942878, 28073696, 29901178, 30067423, 30237737, 31656671		★☆☆☆☆ Found in Text Mining only
NONAKA MYOPATHY	Inclusion body myopathy	BEFREE	19037106		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	22302938, 27500833, 28973648, 29150224, 30203196, 31462690, 31503544		★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	39463224	Associate	★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	23276927		★☆☆☆☆ Found in Text Mining only
Ovarian Carcinoma	Ovarian Carcinoma	BEFREE	28259910		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	28259910		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	28259910	Inhibit	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	32541517, 35941978	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	29706374		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	BEFREE	30405152		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	23175188	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	BEFREE	30405152		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	17588900, 23417962, 24792244, 28168426, 28257421, 28379951, 28478325, 28634568, 29273397, 29654491, 30364275, 30562735, 30572013, 31105527, 31214610, 31244600, 31812544		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	LHGDN	17708669		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	30562735, 31214610	Associate	★☆☆☆☆ Found in Text Mining only
Parkinsonian Disorders	Parkinson Disease	BEFREE	31244600		★☆☆☆☆ Found in Text Mining only
Periapical Periodontitis	Periapical Periodontitis	BEFREE	29363137		★☆☆☆☆ Found in Text Mining only
Premature aging syndrome	Premature aging	BEFREE	18337721		★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	BEFREE	31471557		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	29262808		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	19075016, 26847404, 29262808	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	20562129	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Eosinophilia	Pulmonary Eosinophilia	BEFREE	30668546		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	30261494		★☆☆☆☆ Found in Text Mining only
Renal fibrosis	Renal fibrosis	BEFREE	29614506		★☆☆☆☆ Found in Text Mining only
Rett Syndrome	Rett Syndrome	BEFREE	25209898		★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	BEFREE	25341037		★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	25341037		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Secondary malignant neoplasm of colon and/or rectum	Colorectal Neoplasms	BEFREE	28088387		★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	27500833, 28503576, 30203196, 30216989		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	31656671		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	23475622	Associate	★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	31197036		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	29088792, 29693338, 29925042		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	28061480	Associate	★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	37794467	Associate	★☆☆☆☆ Found in Text Mining only
synovial sarcoma	Synovial sarcoma	BEFREE	25341037		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	35136826	Associate	★☆☆☆☆ Found in Text Mining only
Urethral Obstruction	Urethral Obstruction	BEFREE	29614506		★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	25794641, 32176025	Associate	★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal melanoma	Pubtator	26940009	Associate	★☆☆☆☆ Found in Text Mining only