Gene Gene information from NCBI Gene database.
Entrez ID 22919
Gene name Microtubule associated protein RP/EB family member 1
Gene symbol MAPRE1
Synonyms (NCBI Gene)
EB1
Chromosome 20
Chromosome location 20q11.21
Summary The protein encoded by this gene was first identified by its binding to the APC protein which is often mutated in familial and sporadic forms of colorectal cancer. This protein localizes to microtubules, especially the growing ends, in interphase cells. D
miRNA miRNA information provided by mirtarbase database.
828
miRTarBase ID miRNA Experiments Reference
MIRT007026 hsa-miR-10b-5p Luciferase reporter assay 21562367
MIRT007026 hsa-miR-10b-5p Luciferase reporter assay 21562367
MIRT023330 hsa-miR-122-5p Microarray 17612493
MIRT027584 hsa-miR-98-5p Microarray 19088304
MIRT049331 hsa-miR-92a-3p Luciferase reporter assayqRT-PCR 23622248
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
56
GO ID Ontology Definition Evidence Reference
GO:0000132 Process Establishment of mitotic spindle orientation IDA 34608293
GO:0000922 Component Spindle pole IEA
GO:0001578 Process Microtubule bundle formation IEA
GO:0003723 Function RNA binding HDA 22681889
GO:0005515 Function Protein binding IPI 10226031, 10644998, 10773885, 11943150, 15631994, 16455083, 17563362, 17828277, 18477699, 19543227, 19553473, 19632184, 21303978, 21646404, 21820309, 23574715, 23874158, 24997520, 25225338, 25416956, 26242911, 26485573, 26496610, 26638075, 27107012, 27173435, 28514442, 29162697, 299
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
603108 6890 ENSG00000101367
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q15691
Protein name Microtubule-associated protein RP/EB family member 1 (APC-binding protein EB1) (End-binding protein 1) (EB1)
Protein function Plus-end tracking protein (+TIP) that binds to the plus-end of microtubules and regulates the dynamics of the microtubule cytoskeleton (PubMed:12388762, PubMed:16109370, PubMed:19632184, PubMed:21646404, PubMed:23001180, PubMed:28726242, PubMed:
PDB 1PA7 , 1TXQ , 1UEG , 1VKA , 1WU9 , 1YIB , 1YIG , 2HKQ , 2HL3 , 2HL5 , 2QJZ , 2R8U , 3GJO , 3MTU , 3MUD , 3TQ7 , 4XA1 , 4XA3 , 4XA6 , 5JV3 , 5JVM , 5JVP , 5JVR , 5JVS , 5JVU , 5JX1 , 5WLQ , 6PF2 , 6PFP , 6YF5 , 6YSH
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00307 CH 14 120 Calponin homology (CH) domain Domain
PF03271 EB1 210 248 EB1-like C-terminal motif Family
Tissue specificity TISSUE SPECIFICITY: Ubiquitously expressed. {ECO:0000269|PubMed:10644998}.
Sequence
MAVNVYSTSVTSDNLSRHDMLAWINESLQLNLTKIEQLCSGAAYCQFMDMLFPGSIALKK
VKFQAKLEHEYIQNFKILQAGFKRMGVDKIIPVDKLVKGKFQDNFEFVQWFKKFFDANYD

GKDYDPVAARQGQETAVAPSLVAPALNKPKKPLTSSSAAPQRPISTQRTAAAPKAGPGVV
RKNPGVGNGDDEAAELMQQVNVLKLTVEDLEKERDFYFGKLRNIELICQENEGENDPVLQ
RIVDILYA
TDEGFVIPDEGGPQEEQEEY
Sequence length 268
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal
Separation of Sister Chromatids
Resolution of Sister Chromatid Cohesion
Regulation of PLK1 Activity at G2/M Transition
Loss of Nlp from mitotic centrosomes
Recruitment of mitotic centrosome proteins and complexes
Loss of proteins required for interphase microtubule organization from the centrosome
Recruitment of NuMA to mitotic centrosomes
Anchoring of the basal body to the plasma membrane
RHO GTPases Activate Formins
Mitotic Prometaphase
The role of GTSE1 in G2/M progression after G2 checkpoint
AURKA Activation by TPX2
EML4 and NUDC in mitotic spindle formation
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
5
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
ATTENTION DEFICIT HYPERACTIVITY DISORDER GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
MYOCARDIAL ISCHEMIA CTD, Disgenet
CTD, Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
POLYCYSTIC OVARY SYNDROME GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
PROSTATE CANCER GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Acute lymphocytic leukemia Lymphocytic Leukemia BEFREE 15751040
★☆☆☆☆
Found in Text Mining only
Adenomatous Polyposis Coli Multiple polyposis syndrome BEFREE 18075263, 18937283, 19573802, 24492008, 9823979
★☆☆☆☆
Found in Text Mining only
Aneuploidy Aneuploidy Pubtator 16763565 Associate
★☆☆☆☆
Found in Text Mining only
Breast Carcinoma Breast Carcinoma BEFREE 24748116, 30368744
★☆☆☆☆
Found in Text Mining only
Breast Neoplasms Breast neoplasm Pubtator 24748116, 30368744 Associate
★☆☆☆☆
Found in Text Mining only
Carcinogenesis Carcinogenesis Pubtator 16763565 Associate
★☆☆☆☆
Found in Text Mining only
Carcinoma Hepatocellular Hepatocellular carcinoma Pubtator 24614035 Associate
★☆☆☆☆
Found in Text Mining only
Carcinoma of lung Lung carcinoma BEFREE 23900080, 29484424
★☆☆☆☆
Found in Text Mining only
Chronobiology Disorders Chronobiology disorder Pubtator 31712236 Associate
★☆☆☆☆
Found in Text Mining only
Classical Lissencephaly Lissencephaly BEFREE 28406398
★☆☆☆☆
Found in Text Mining only