Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	22918
Gene name	CD93 molecule
Gene symbol	CD93
Synonyms (NCBI Gene)	C1QR1C1qR(P)C1qRPCDw93ECSM3MXRA4dJ737E23.1
Chromosome	20
Chromosome location	20p11.21
Summary	The protein encoded by this gene is a cell-surface glycoprotein and type I membrane protein that was originally identified as a myeloid cell-specific marker. The encoded protein was once thought to be a receptor for C1q, but now is thought to instead be i

118

Show/Hide all (118)

miRTarBase ID	miRNA	Experiments	Reference
MIRT438266	hsa-miR-29a-3p	Luciferase reporter assay	24085298
MIRT438266	hsa-miR-29a-3p	Luciferase reporter assay	24085298
MIRT608460	hsa-miR-6867-5p	HITS-CLIP	24906430
MIRT608459	hsa-miR-6818-5p	HITS-CLIP	24906430
MIRT608458	hsa-miR-574-5p	HITS-CLIP	24906430
MIRT532272	hsa-miR-499a-3p	PAR-CLIP	22012620
MIRT532270	hsa-miR-499b-3p	PAR-CLIP	22012620
MIRT532271	hsa-miR-5007-5p	PAR-CLIP	22012620
MIRT532269	hsa-miR-5002-3p	PAR-CLIP	22012620
MIRT532268	hsa-miR-377-3p	PAR-CLIP	22012620
MIRT575141	hsa-miR-574-5p	PAR-CLIP	27292025
MIRT575142	hsa-miR-6818-5p	PAR-CLIP	27292025
MIRT575144	hsa-miR-6867-5p	PAR-CLIP	27292025
MIRT532272	hsa-miR-499a-3p	PAR-CLIP	22012620
MIRT532270	hsa-miR-499b-3p	PAR-CLIP	22012620
MIRT532271	hsa-miR-5007-5p	PAR-CLIP	22012620
MIRT532269	hsa-miR-5002-3p	PAR-CLIP	22012620
MIRT532268	hsa-miR-377-3p	PAR-CLIP	22012620
MIRT876451	hsa-miR-1185	CLIP-seq
MIRT876452	hsa-miR-1238	CLIP-seq
MIRT876453	hsa-miR-1247	CLIP-seq
MIRT876454	hsa-miR-1285	CLIP-seq
MIRT876455	hsa-miR-1297	CLIP-seq
MIRT876456	hsa-miR-1321	CLIP-seq
MIRT876457	hsa-miR-1324	CLIP-seq
MIRT876458	hsa-miR-141	CLIP-seq
MIRT876459	hsa-miR-187	CLIP-seq
MIRT876460	hsa-miR-200a	CLIP-seq
MIRT876461	hsa-miR-2392	CLIP-seq
MIRT876462	hsa-miR-26a	CLIP-seq
MIRT876463	hsa-miR-26b	CLIP-seq
MIRT876464	hsa-miR-3148	CLIP-seq
MIRT876465	hsa-miR-3150b-3p	CLIP-seq
MIRT876466	hsa-miR-3162-5p	CLIP-seq
MIRT876467	hsa-miR-3173-3p	CLIP-seq
MIRT876468	hsa-miR-3187-5p	CLIP-seq
MIRT876469	hsa-miR-3605-5p	CLIP-seq
MIRT876470	hsa-miR-3679-3p	CLIP-seq
MIRT876471	hsa-miR-3679-5p	CLIP-seq
MIRT876472	hsa-miR-3688-3p	CLIP-seq
MIRT876473	hsa-miR-3691-3p	CLIP-seq
MIRT876474	hsa-miR-4260	CLIP-seq
MIRT876475	hsa-miR-4310	CLIP-seq
MIRT876476	hsa-miR-432	CLIP-seq
MIRT876477	hsa-miR-4325	CLIP-seq
MIRT876478	hsa-miR-4328	CLIP-seq
MIRT876479	hsa-miR-4419a	CLIP-seq
MIRT876480	hsa-miR-4427	CLIP-seq
MIRT876481	hsa-miR-4428	CLIP-seq
MIRT876482	hsa-miR-4435	CLIP-seq
MIRT876483	hsa-miR-4443	CLIP-seq
MIRT876484	hsa-miR-4465	CLIP-seq
MIRT876485	hsa-miR-4477b	CLIP-seq
MIRT876486	hsa-miR-4510	CLIP-seq
MIRT876487	hsa-miR-4635	CLIP-seq
MIRT876488	hsa-miR-4677-3p	CLIP-seq
MIRT876489	hsa-miR-4679	CLIP-seq
MIRT876490	hsa-miR-4680-3p	CLIP-seq
MIRT876491	hsa-miR-4709-3p	CLIP-seq
MIRT876492	hsa-miR-4711-3p	CLIP-seq
MIRT876493	hsa-miR-4739	CLIP-seq
MIRT876494	hsa-miR-4756-5p	CLIP-seq
MIRT876495	hsa-miR-4784	CLIP-seq
MIRT876496	hsa-miR-4790-3p	CLIP-seq
MIRT876497	hsa-miR-487a	CLIP-seq
MIRT876498	hsa-miR-498	CLIP-seq
MIRT876499	hsa-miR-539	CLIP-seq
MIRT876500	hsa-miR-570	CLIP-seq
MIRT876501	hsa-miR-593	CLIP-seq
MIRT876502	hsa-miR-604	CLIP-seq
MIRT876503	hsa-miR-605	CLIP-seq
MIRT876504	hsa-miR-612	CLIP-seq
MIRT876505	hsa-miR-642b	CLIP-seq
MIRT876506	hsa-miR-647	CLIP-seq
MIRT876507	hsa-miR-765	CLIP-seq
MIRT876508	hsa-miR-891b	CLIP-seq
MIRT876509	hsa-miR-892a	CLIP-seq
MIRT876459	hsa-miR-187	CLIP-seq
MIRT1959746	hsa-miR-4694-3p	CLIP-seq
MIRT1959747	hsa-miR-4698	CLIP-seq
MIRT1959748	hsa-miR-4711-5p	CLIP-seq
MIRT1959749	hsa-miR-4749-3p	CLIP-seq
MIRT876496	hsa-miR-4790-3p	CLIP-seq
MIRT876501	hsa-miR-593	CLIP-seq
MIRT876459	hsa-miR-187	CLIP-seq
MIRT2196798	hsa-miR-3138	CLIP-seq
MIRT2196799	hsa-miR-3180-5p	CLIP-seq
MIRT2196800	hsa-miR-3545-3p	CLIP-seq
MIRT2196801	hsa-miR-4318	CLIP-seq
MIRT876477	hsa-miR-4325	CLIP-seq
MIRT1959748	hsa-miR-4711-5p	CLIP-seq
MIRT876496	hsa-miR-4790-3p	CLIP-seq
MIRT2196802	hsa-miR-4800-5p	CLIP-seq
MIRT2196803	hsa-miR-520a-5p	CLIP-seq
MIRT2196804	hsa-miR-525-5p	CLIP-seq
MIRT876501	hsa-miR-593	CLIP-seq
MIRT2196805	hsa-miR-607	CLIP-seq
MIRT2385812	hsa-miR-3922-5p	CLIP-seq
MIRT876451	hsa-miR-1185	CLIP-seq
MIRT2446630	hsa-miR-1193	CLIP-seq
MIRT876461	hsa-miR-2392	CLIP-seq
MIRT2446631	hsa-miR-330-3p	CLIP-seq
MIRT2196800	hsa-miR-3545-3p	CLIP-seq
MIRT876469	hsa-miR-3605-5p	CLIP-seq
MIRT2446632	hsa-miR-3652	CLIP-seq
MIRT2446633	hsa-miR-3662	CLIP-seq
MIRT876471	hsa-miR-3679-5p	CLIP-seq
MIRT2446634	hsa-miR-3921	CLIP-seq
MIRT2446635	hsa-miR-4430	CLIP-seq
MIRT2446636	hsa-miR-4505	CLIP-seq
MIRT2446637	hsa-miR-4649-3p	CLIP-seq
MIRT2446638	hsa-miR-4653-5p	CLIP-seq
MIRT2499928	hsa-miR-1255a	CLIP-seq
MIRT2499929	hsa-miR-1255b	CLIP-seq
MIRT2499930	hsa-miR-4760-3p	CLIP-seq
MIRT2499928	hsa-miR-1255a	CLIP-seq
MIRT2499929	hsa-miR-1255b	CLIP-seq
MIRT2499930	hsa-miR-4760-3p	CLIP-seq

Show/Hide all (22)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001525	Process	Angiogenesis	IDA	29763414
GO:0001525	Process	Angiogenesis	IDA	28671670
GO:0001849	Function	Complement component C1q complex binding	IDA	11781389
GO:0005509	Function	Calcium ion binding	IEA
GO:0005515	Function	Protein binding	IPI	15459234, 15819698
GO:0005886	Component	Plasma membrane	IDA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006909	Process	Phagocytosis	NAS	9047234, 10092817, 11781389
GO:0007155	Process	Cell adhesion	IEA
GO:0009986	Component	Cell surface	IEA
GO:0016020	Component	Membrane	IEA
GO:0030246	Function	Carbohydrate binding	IEA
GO:0030667	Component	Secretory granule membrane	TAS
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0035579	Component	Specific granule membrane	TAS
GO:0038023	Function	Signaling receptor activity	IDA	28671670
GO:0038023	Function	Signaling receptor activity	NAS	9047234
GO:0042116	Process	Macrophage activation	NAS	9047234
GO:0070821	Component	Tertiary granule membrane	TAS
GO:0098609	Process	Cell-cell adhesion	IDA	11994479
GO:0101003	Component	Ficolin-1-rich granule membrane	TAS

MIM	HGNC	e!Ensembl
120577	15855	ENSG00000125810

Q9NPY3

Protein name

Complement component C1q receptor (C1q/MBL/SPA receptor) (C1qR) (C1qR(p)) (C1qRp) (CDw93) (Complement component 1 q subcomponent receptor 1) (Matrix-remodeling-associated protein 4) (CD antigen CD93)

Protein function

Cell surface receptor that plays a role in various physiological processes including inflammation, phagocytosis, and cell adhesion. Plays a role in phagocytosis and enhances the uptake of apoptotic cells and immune complexes by acting as a recep

PDB

8A59 , 8IVD

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00059	Lectin_C	42 → 181	Lectin C-type domain	Domain
PF12662	cEGF	325 → 348	Complement Clr-like EGF-like	Domain
PF12662	cEGF	406 → 430	Complement Clr-like EGF-like	Domain

Tissue specificity

TISSUE SPECIFICITY: Highly expressed in endothelial cells, platelets, cells of myeloid origin, such as monocytes and neutrophils. Not expressed in cells of lymphoid origin.

Sequence

MATSMGLLLLLLLLLTQPGAGTGADTEAVVCVGTACYTAHSGKLSAAEAQNHCNQNGGNL
ATVKSKEEAQHVQRVLAQLLRREAALTARMSKFWIGLQREKGKCLDPSLPLKGFSWVGGG
EDTPYSNWHKELRNSCISKRCVSLLLDLSQPLLPSRLPKWSEGPCGSPGSPGSNIEGFVC
KFSFKGMCRPLALGGPGQVTYTTPFQTTSSSLEAVPFASAANVACGEGDKDETQSHYFLC
KEKAPDVFDWGSSGPLCVSPKYGCNFNNGGCHQDCFEGGDGSFLCGCRPGFRLLDDLVTC
ASRNPCSSSPCRGGATCVLGPHGKNYTCRCPQGYQLDSSQLDCVDVDECQDSPCAQECVN
TPGGFRCECWVGYEPGGPGEGACQDVDECALGRSPCAQGCTNTDGSFHCSCEEGYVLAGE
DGTQCQDVDECVGPGGPLCDSLCFNTQGSFHCGCLPGWVLAPNGVSCTMGPVSLGPPSGP
PDEEDKGEKEGSTVPRAATASPTRGPEGTPKATPTTSRPSLSSDAPITSAPLKMLAPSGS
PGVWREPSIHHATAASGPQEPAGGDSSVATQNNDGTDGQKLLLFYILGTVVAILLLLALA
LGLLVYRKRRAKREEKKEKKPQNAADSYSWVPERAESRAMENQYSPTPGTDC

Sequence length

652

Interactions

View interactions

	Reactome
			Neutrophil degranulation

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (5)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CD93-related disorder	Uncertain significance; Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CENTRAL NERVOUS SYSTEM CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOBLASTOMA MULTIFORME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VENOUS THROMBOEMBOLISM	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (41)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute Undifferentiated Leukemia	Leukemia	BEFREE	26387756		★★★★★ ★☆☆☆☆ Found in Text Mining only
Age related macular degeneration	Age-related macular degeneration	BEFREE	27859225		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	29498549		★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	26363010		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	30670769	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Adenoid Cystic	Adenoid cystic carcinoma	Pubtator	21551254	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	37483608	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	33173973	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	26008729		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	UNIPROT_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	26008729	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	21332844		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	21332844		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	21332844	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Disease	Coronary artery disease	Pubtator	18599554	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	18599554, 21332844		★★★★★ ★☆☆☆☆ Found in Text Mining only
Exudative age-related macular degeneration	Exudative Macular Degeneration	BEFREE	27859225		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	26363010		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	26363010		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioma	Glioma	BEFREE	26363010		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioma	Glioma	Pubtator	36006582	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heart Diseases	Heart disease	Pubtator	33173973	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	26387756	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	26387756, 29720577	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	26387756		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	39190192	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	29763414		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	26008729, 27255994		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	31182688, 32760394	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	21332844		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	21332844	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	27255994		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	26008729, 26363010, 26387756, 27255994, 27859225, 28671670, 29763414, 31819775		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	31335975	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	31819775		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	28421233		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	8349314		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	35065254, 36690975, 36761750, 39190192	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombosis	Thrombosis	Pubtator	39190192	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular System Injuries	Vascular system injury	Pubtator	19828637	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vasculitis	Vasculitis	Pubtator	28962592	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

CD93 (CD93 molecule)