Gene Gene information from NCBI Gene database.
Entrez ID 22914
Gene name Killer cell lectin like receptor K1
Gene symbol KLRK1
Synonyms (NCBI Gene)
CD314D12S2489EKLRNKG2-DNKG2D
Chromosome 12
Chromosome location 12p13.2
Summary Natural killer (NK) cells are lymphocytes that can mediate lysis of certain tumor cells and virus-infected cells without previous activation. They can also regulate specific humoral and cell-mediated immunity. NK cells preferentially express several calci
miRNA miRNA information provided by mirtarbase database.
24
miRTarBase ID miRNA Experiments Reference
MIRT017175 hsa-miR-335-5p Microarray 18185580
MIRT019249 hsa-miR-148b-3p Microarray 17612493
MIRT021363 hsa-miR-9-5p Microarray 17612493
MIRT1099411 hsa-miR-103b CLIP-seq
MIRT1099412 hsa-miR-1236 CLIP-seq
Transcription factors Transcription factors information provided by TRRUST V2 database.
1
Transcription factor Regulation Reference
ATM Activation 19767562
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
43
GO ID Ontology Definition Evidence Reference
GO:0002223 Process Stimulatory C-type lectin receptor signaling pathway IEA
GO:0002250 Process Adaptive immune response IEA
GO:0002376 Process Immune system process IEA
GO:0005515 Function Protein binding IPI 10426993, 10426994, 11323699, 11754823, 15240696, 18544572, 19424970, 19436053, 19658097, 21712812, 23696226, 28559451, 32296183
GO:0005886 Component Plasma membrane IDA 17562706
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
611817 18788 ENSG00000213809
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P26718
Protein name NKG2-D type II integral membrane protein (Killer cell lectin-like receptor subfamily K member 1) (NK cell receptor D) (NKG2-D-activating NK receptor) (CD antigen CD314)
Protein function Functions as an activating and costimulatory receptor involved in immunosurveillance upon binding to various cellular stress-inducible ligands displayed at the surface of autologous tumor cells and virus-infected cells. Provides both stimulatory
PDB 1HYR , 1KCG , 1MPU , 4PDC , 4S0U , 8TM0 , 8TM2 , 9DH2
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00059 Lectin_C 116 213 Lectin C-type domain Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in natural killer (NK) cells, CD8(+) alpha-beta and gamma-delta T-cells. Expressed on essentially all CD56+CD3- NK cells from freshly isolated PBMC. Expressed in interferon-producing killer dendritic cells (IKDCs). {ECO:00002
Sequence
MGWIRGRRSRHSWEMSEFHNYNLDLKKSDFSTRWQKQRCPVVKSKCRENASPFFFCCFIA
VAMGIRFIIMVAIWSAVFLNSLFNQEVQIPLTESYCGPCPKNWICYKNNCYQFFDESKNW
YESQASCMSQNASLLKVYSKEDQDLLKLVKSYHWMGLVHIPTNGSWQWEDGSILSPNLLT
IIEMQKGDCALYASSFKGYIENCSTPNTYICMQ
RTV
Sequence length 216
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Natural killer cell mediated cytotoxicity
Malaria
  Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell
DAP12 signaling
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
2
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
MELANOMA CTD
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
TROPICAL SPASTIC PARAPARESIS Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Acute lymphocytic leukemia Lymphocytic Leukemia BEFREE 24856896
★☆☆☆☆
Found in Text Mining only
Acute monocytic leukemia Monocytic Leukemia BEFREE 24677544
★☆☆☆☆
Found in Text Mining only
Acute myeloid leukemia, minimal differentiation Myeloid Leukemia BEFREE 16239914
★☆☆☆☆
Found in Text Mining only
Acute Promyelocytic Leukemia Promyelocytic Leukemia BEFREE 19151770
★☆☆☆☆
Found in Text Mining only
Acute Undifferentiated Leukemia Leukemia BEFREE 22406996
★☆☆☆☆
Found in Text Mining only
Adenocarcinoma Adenocarcinoma LHGDN 17635809
★☆☆☆☆
Found in Text Mining only
Adenomatous Polyposis Coli Multiple polyposis syndrome BEFREE 17267578
★☆☆☆☆
Found in Text Mining only
Adult Hodgkin Lymphoma Hodgkin Lymphoma BEFREE 23787466
★☆☆☆☆
Found in Text Mining only
Alopecia Alopecia BEFREE 21689246, 31323149
★☆☆☆☆
Found in Text Mining only
Alopecia Areata Alopecia Areata BEFREE 21689246, 31323149
★☆☆☆☆
Found in Text Mining only