Gene Gene information from NCBI Gene database.
Entrez ID 22909
Gene name FANCD2 and FANCI associated nuclease 1
Gene symbol FAN1
Synonyms (NCBI Gene)
KIAA1018KMINMTMR15hFAN1
Chromosome 15
Chromosome location 15q13.3
Summary This gene plays a role in DNA interstrand cross-link repair and encodes a protein with 5` flap endonuclease and 5`-3` exonuclease activity. Mutations in this gene cause karyomegalic interstitial nephritis. Alternatively spliced transcript variants encodin
SNPs SNP information provided by dbSNP.
6
SNP ID Visualize variation Clinical significance Consequence
rs761988851 T>- Pathogenic Genic downstream transcript variant, frameshift variant, non coding transcript variant, 3 prime UTR variant, coding sequence variant
rs767435461 T>A Pathogenic Intron variant, splice donor variant
rs774499986 GT>- Likely-pathogenic Intron variant, coding sequence variant, non coding transcript variant, frameshift variant, 5 prime UTR variant
rs778075842 C>G,T Pathogenic Intron variant, coding sequence variant, stop gained, non coding transcript variant, 5 prime UTR variant, missense variant
rs781134478 T>G Likely-pathogenic Intron variant, coding sequence variant, non coding transcript variant, 5 prime UTR variant, missense variant
miRNA miRNA information provided by mirtarbase database.
83
miRTarBase ID miRNA Experiments Reference
MIRT036619 hsa-miR-940 CLASH 23622248
MIRT988920 hsa-miR-3616-5p CLIP-seq
MIRT988921 hsa-miR-3647-5p CLIP-seq
MIRT988922 hsa-miR-548c-3p CLIP-seq
MIRT988923 hsa-miR-573 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
37
GO ID Ontology Definition Evidence Reference
GO:0000287 Function Magnesium ion binding TAS 20603016
GO:0000724 Process Double-strand break repair via homologous recombination IMP 20603015, 20603016
GO:0003676 Function Nucleic acid binding IEA
GO:0003677 Function DNA binding IEA
GO:0004518 Function Nuclease activity IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
613534 29170 ENSG00000198690
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9Y2M0
Protein name Fanconi-associated nuclease 1 (EC 3.1.21.-) (EC 3.1.4.1) (FANCD2/FANCI-associated nuclease 1) (hFAN1) (Myotubularin-related protein 15)
Protein function Nuclease required for the repair of DNA interstrand cross-links (ICL) recruited at sites of DNA damage by monoubiquitinated FANCD2. Specifically involved in repair of ICL-induced DNA breaks by being required for efficient homologous recombinatio
PDB 4REA , 4REB , 4REC , 4RI8 , 4RI9 , 4RIA , 4RIB , 4RIC , 4RID , 4RY3 , 8S5A , 9CG4 , 9CHM , 9CL7 , 9CMA , 9EO1 , 9EOA , 9GY0
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF08774 VRR_NUC 893 1008 VRR-NUC domain Domain
Sequence
MMSEGKPPDKKRPRRSLSISKNKKKASNSIISCFNNAPPAKLACPVCSKMVPRYDLNRHL
DEMCANNDFVQVDPGQVGLINSNVSMVDLTSVTLEDVTPKKSPPPKTNLTPGQSDSAKRE
VKQKISPYFKSNDVVCKNQDELRNRSVKVICLGSLASKLSRKYVKAKKSIDKDEEFAGSS
PQSSKSTVVKSLIDNSSEIEDEDQILENSSQKENVFKCDSLKEECIPEHMVRGSKIMEAE
SQKATRECEKSALTPGFSDNAIMLFSPDFTLRNTLKSTSEDSLVKQECIKEVVEKREACH
CEEVKMTVASEAKIQLSDSEAKSHSSADDASAWSNIQEAPLQDDSCLNNDIPHSIPLEQG
SSCNGPGQTTGHPYYLRSFLVVLKTVLENEDDMLLFDEQEKGIVTKFYQLSATGQKLYVR
LFQRKLSWIKMTKLEYEEIALDLTPVIEELTNAGFLQTESELQELSEVLELLSAPELKSL
AKTFHLVNPNGQKQQLVDAFLKLAKQRSVCTWGKNKPGIGAVILKRAKALAGQSVRICKG
PRAVFSRILLLFSLTDSMEDEDAACGGQGQLSTVLLVNLGRMEFPSYTINRKTHIFQDRD
DLIRYAAATHMLSDISSAMANGNWEEAKELAQCAKRDWNRLKNHPSLRCHEDLPLFLRCF
TVGWIYTRILSRFVEILQRLHMYEEAVRELESLLSQRIYCPDSRGRWWDRLALNLHQHLK
RLEPTIKCITEGLADPEVRTGHRLSLYQRAVRLRESPSCKKFKHLFQQLPEMAVQDVKHV
TITGRLCPQRGMCKSVFVMEAGEAADPTTVLCSVEELALAHYRRSGFDQGIHGEGSTFST
LYGLLLWDIIFMDGIPDVFRNACQAFPLDLCTDSFFTSRRPALEARLQLIHDAPEESLRA
WVAATWHEQEGRVASLVSWDRFTSLQQAQDLVSCLGGPVLSGVCRHLAADFRHCRGGLPD
LVVWNSQSRHFKLVEVKGPNDRLSHKQMIWLAELQKLGAEVEVCHVVA
VGAKSQSLS
Sequence length 1017
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Fanconi anemia pathway   Fanconi Anemia Pathway
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
18
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession Evidence Score
FAN1-related disorder Likely pathogenic; Pathogenic rs144469584, rs387907279 RCV003421140
RCV004751230
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Karyomegalic interstitial nephritis Likely pathogenic; Pathogenic rs2140895653, rs2140913969, rs767651793, rs199845994, rs748666715, rs144469584, rs746677293, rs774499986, rs778075842, rs750056424, rs953653119, rs767435461, rs1566921085, rs387907279, rs1305708707
View all (5 more)
RCV001536087
RCV001536108
RCV001849664
RCV005010902
RCV005356161
View all (15 more)
★★★★★
ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Kidney failure Likely pathogenic; Pathogenic rs761988851 RCV005626297
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
Acute myeloid leukemia Benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Familial cancer of breast Benign; Likely benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Gastric cancer Benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Hereditary breast ovarian cancer syndrome Conflicting classifications of pathogenicity; Uncertain significance ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Adenocarcinoma of pancreas Pancreatic adenocarcinoma HPO_DG
★☆☆☆☆
Found in Text Mining only
Agnosia Agnosia HPO_DG
★☆☆☆☆
Found in Text Mining only
Anxiety Anxiety Disorder HPO_DG
★☆☆☆☆
Found in Text Mining only
Attention deficit hyperactivity disorder Attention Deficit Hyperactivity Disorder HPO_DG
★☆☆☆☆
Found in Text Mining only
Autism Spectrum Disorder Autism Pubtator 24344280 Associate
★☆☆☆☆
Found in Text Mining only
Autism Spectrum Disorders Autism Spectrum Disorder BEFREE 24344280
★☆☆☆☆
Found in Text Mining only
Autistic Disorder Autism BEFREE 24344280
★☆☆☆☆
Found in Text Mining only
Autistic Disorder Autism Pubtator 24344280 Associate
★☆☆☆☆
Found in Text Mining only
Benign neoplasm of central nervous system Benign Neoplasm Of Nervous System HPO_DG
★☆☆☆☆
Found in Text Mining only
Breast Carcinoma Breast Carcinoma BEFREE 21858661
★☆☆☆☆
Found in Text Mining only