SBNO2 (strawberry notch homolog 2)

Gene

• Entrez ID: 22904
• Gene name: Strawberry notch homolog 2
• Gene symbol: SBNO2
• Synonyms (NCBI Gene): KIAA0963, SNO, STNO
• Chromosome: 19
• Chromosome location: 19p13.3

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT022166	hsa-miR-124-3p	Microarray	18668037
MIRT028257	hsa-miR-32-5p	Sequencing	20371350
MIRT050357	hsa-miR-25-3p	CLASH	23622248
MIRT1327209	hsa-miR-1275	CLIP-seq
MIRT1327210	hsa-miR-153	CLIP-seq
MIRT1327211	hsa-miR-2964a-3p	CLIP-seq
MIRT1327212	hsa-miR-4419a	CLIP-seq
MIRT1327213	hsa-miR-4446-3p	CLIP-seq
MIRT1327214	hsa-miR-448	CLIP-seq
MIRT1327215	hsa-miR-4492	CLIP-seq
MIRT1327216	hsa-miR-4498	CLIP-seq
MIRT1327217	hsa-miR-4505	CLIP-seq
MIRT1327218	hsa-miR-4510	CLIP-seq
MIRT1327219	hsa-miR-4525	CLIP-seq
MIRT1327220	hsa-miR-4665-5p	CLIP-seq
MIRT1327221	hsa-miR-4723-5p	CLIP-seq
MIRT1327222	hsa-miR-4728-5p	CLIP-seq
MIRT1327223	hsa-miR-4731-5p	CLIP-seq
MIRT1327224	hsa-miR-625	CLIP-seq
MIRT1327225	hsa-miR-637	CLIP-seq
MIRT1327226	hsa-miR-762	CLIP-seq
MIRT1327227	hsa-miR-1200	CLIP-seq
MIRT1327228	hsa-miR-125a-5p	CLIP-seq
MIRT1327229	hsa-miR-125b	CLIP-seq
MIRT1327230	hsa-miR-3074-5p	CLIP-seq
MIRT1327231	hsa-miR-3170	CLIP-seq
MIRT1327232	hsa-miR-3663-3p	CLIP-seq
MIRT1327233	hsa-miR-4319	CLIP-seq
MIRT1327234	hsa-miR-4324	CLIP-seq
MIRT1327235	hsa-miR-544b	CLIP-seq
MIRT2097173	hsa-miR-1234	CLIP-seq
MIRT2097174	hsa-miR-124	CLIP-seq
MIRT2097175	hsa-miR-2861	CLIP-seq
MIRT1327211	hsa-miR-2964a-3p	CLIP-seq
MIRT2097176	hsa-miR-3192	CLIP-seq
MIRT1327234	hsa-miR-4324	CLIP-seq
MIRT2097177	hsa-miR-4493	CLIP-seq
MIRT2097178	hsa-miR-4750	CLIP-seq
MIRT2097179	hsa-miR-4792	CLIP-seq
MIRT2097180	hsa-miR-506	CLIP-seq
MIRT1327235	hsa-miR-544b	CLIP-seq
MIRT2097181	hsa-miR-661	CLIP-seq
MIRT2321514	hsa-miR-1225-3p	CLIP-seq
MIRT2321515	hsa-miR-499-3p	CLIP-seq
MIRT2321516	hsa-miR-499a-3p	CLIP-seq
MIRT2394064	hsa-miR-1280	CLIP-seq
MIRT2394065	hsa-miR-4286	CLIP-seq
MIRT2442588	hsa-miR-361-3p	CLIP-seq
MIRT2442589	hsa-miR-4707-5p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001503	Process	Ossification	IEA
GO:0002281	Process	Macrophage activation involved in immune response	IBA
GO:0002281	Process	Macrophage activation involved in immune response	IEA
GO:0002281	Process	Macrophage activation involved in immune response	IMP	18025162
GO:0005634	Component	Nucleus	IBA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0030154	Process	Cell differentiation	IEA
GO:0030282	Process	Bone mineralization	IEA
GO:0030316	Process	Osteoclast differentiation	IBA
GO:0030316	Process	Osteoclast differentiation	IEA
GO:0031490	Function	Chromatin DNA binding	IBA
GO:0042393	Function	Histone binding	IBA
GO:0045892	Process	Negative regulation of DNA-templated transcription	IBA
GO:0045892	Process	Negative regulation of DNA-templated transcription	IEA
GO:0045892	Process	Negative regulation of DNA-templated transcription	IMP	18025162
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IBA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0050727	Process	Regulation of inflammatory response	IBA
GO:0050727	Process	Regulation of inflammatory response	IEA
GO:0050727	Process	Regulation of inflammatory response	IMP	18025162
GO:0061430	Process	Bone trabecula morphogenesis	IEA
GO:0071222	Process	Cellular response to lipopolysaccharide	IEA
GO:0071222	Process	Cellular response to lipopolysaccharide	ISS
GO:0071348	Process	Cellular response to interleukin-11	IEA
GO:0071348	Process	Cellular response to interleukin-11	ISS
GO:0071354	Process	Cellular response to interleukin-6	IBA
GO:0071354	Process	Cellular response to interleukin-6	IDA	25903009
GO:0071354	Process	Cellular response to interleukin-6	IEA
GO:0072674	Process	Multinuclear osteoclast differentiation	IEA
GO:0072675	Process	Osteoclast fusion	IEA
GO:1990830	Process	Cellular response to leukemia inhibitory factor	IEA
GO:1990830	Process	Cellular response to leukemia inhibitory factor	ISS

Other IDs

• MIM: 615729
• HGNC: 29158
• e!Ensembl: ENSG00000064932

Protein

• UniProt ID: Q9Y2G9
• Protein name: Protein strawberry notch homolog 2
• Protein function: Acts as a transcriptional coregulator, that can have both coactivator and corepressor functions. Inhibits the DCSTAMP-repressive activity of TAL1, hence enhancing the access of the transcription factor MITF to the DC-STAMP promoter in osteoclast
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF13872	AAA_34	215 → 505	P-loop containing NTP hydrolase pore-1	Domain
  PF13871	Helicase_C_4	732 → 1010	C-terminal domain on Strawberry notch homologue	Domain

• Tissue specificity: TISSUE SPECIFICITY: Detected in macrophages. IL10 regulates expression in a STAT3-dependent way. {ECO:0000269|PubMed:18025162}.
• Sequence:

  MLAVGPAMDRDYPQHEPPPAGSLLYSPPPLQSAMLHCPYWNTFSLPPYPAFSSDSRPFMS
  SASFLGSQPCPDTSYAPVATASSLPPKTCDFAQDSSYFEDFSNISIFSSSVDSLSDIVDT
  PDFLPADSLNQVSTIWDDNPAPSTHDKLFQLSRPFAGFEDFLPSHSTPLLVSYQEQSVQS
  QPEEEDEAEEEEAEELGHTETYADYVPSKSKIGKQHPDRVVETSTLSSVPPPDITYTLAL
  PSDSGALSALQLEAITYACQQHEVLLPSGQRAGFLIGDGAGVGKGRTVAGVILENHLRGR
  KKALWFSVSNDLKYDAERDLRDIEATGIAVHALSKIKYGDTTTSEGVLFATYSALIGESQ
  AGGQHRTRLRQILDWCGEAFEGVIVFDECHKAKNAGSTKMGKAVLDLQNKLPLARVVYAS
  ATGASEPRNMIYMSRLGIWGEGTPFRNFEEFLHAIEKRGVGAMEIVAMDMKVSGMYIARQ
  LSFSGVTFRIEEIPLAPAFECVYNRAALLWAEALNVFQQAADWIGLESRKSLWGQFWSAH
  QRFFKYLCIAAKVRRLVELAREELARDKCVVIGLQSTGEARTREVLGENDGHLNCFVSAA
  EGVFLSLIQKHFPSTKRKRDRGAGSKRKRRPRGRGAKAPRLACETAGVIRISDDSSTESD
  PGLDSDFNSSPESLVDDDVVIVDAVGLPSDDRGPLCLLQRDPHGPGVLERVERLKQDLLD
  KVRRLGRELPVNTLDELIDQLGGPQRVAEMTGRKGRVVSRPDGTVAFESRAEQGLSIDHV
  NLREKQRFMSGEKLVAIISEASSSGVSLQADRRVQNQRRRVHMTLELPWSADRAIQQFGR
  THRSNQVSAPEYVFLISELAGERRFASIVAKRLESLGALTHGDRRATESRDLSKYNFENK
  YGTRALHCVLTTILSQTENKVPVPQGYPGGVPTFFRDMKQGLLSVGIGGRESRNGCLDVE
  KDCSITKFLNRILGLEVHKQNALFQYFSDTFDHLIEMDKREGKYDMGILDLAPGIEEIYE
  ESQQVFLAPGHPQDGQVVFYKISVDRGLKWEDAFAKSLALTGPYDGFYLSYKVRGNKPSC
  LLAEQNRGQFFTVYKPNIGRQSQLEALDSLRRKFHRVTAEEAKEPWESGYALSLTHCSHS
  AWNRHCRLAQEGKDCLQGLRLRHHYMLCGALLRVWGRIAAVMADVSSSSYLQIVRLKTKD
  RKKQVGIKIPEGCVRRVLQELRLMDADVKRRQAPALGCPAPPAPRPLALPCGPGEVLDLT
  YSPPAEAFPPPPHFSFPAPLSLDAGPGVVPLGTPDAQADPAALAHQGCDINFKEVLEDML
  RSLHAGPPSEGALGEGAGAGGAAGGGPERQSVIQFSPPFPGAQAPL

• Sequence length: 1366

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ANKYLOSING SPONDYLITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTHMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BASAL CELL CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHILDHOOD ONSET ASTHMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHN'S DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOTHYROIDISM	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KERATINOCYTE CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-MELANOMA SKIN CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RESPIRATORY SYSTEM DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCLEROSING CHOLANGITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC LUPUS ERYTHEMATOSUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ULCERATIVE COLITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Ankylosing spondylitis	Ankylosing Spondylitis	GWASCAT_DG	26974007		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	GWASCAT_DG	30929738		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	29988084		★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	30883663		★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	15700036		★☆☆☆☆ Found in Text Mining only
Childhood asthma	Asthma	GWASCAT_DG	30929738, 31036433		★☆☆☆☆ Found in Text Mining only
Cholangitis, Sclerosing	Cholangitis	GWASCAT_DG	26974007		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	GWASDB_DG	18587394, 21102463, 23128233		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	20570966	Associate	★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	GWASCAT_DG	21102463, 23128233, 26192919, 26974007, 28067908		★☆☆☆☆ Found in Text Mining only
Depressive Disorder Major	Major depressive disorder	Pubtator	22373040	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	26823690		★☆☆☆☆ Found in Text Mining only
Dyskinetic syndrome	Dyskinetic Syndrome	BEFREE	30350722		★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	28530542		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	28530542		★☆☆☆☆ Found in Text Mining only
Glucocorticoid-remediable aldosteronism	Hyperaldosteronism	BEFREE	31649033		★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	23641925		★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	30227269		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	GWASCAT_DG	26192919, 28067908		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	34758847	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	26923760, 27956242, 28530542		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	GWASDB_DG	22190364		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	30446382		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	26854602		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	29097102		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	14581340		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	30397228	Associate	★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	18003920, 25378175, 27267045		★☆☆☆☆ Found in Text Mining only
PARKINSON DISEASE 2, AUTOSOMAL RECESSIVE JUVENILE	Parkinson Disease	BEFREE	29166608		★☆☆☆☆ Found in Text Mining only
Parkinson Disease 6, Autosomal Recessive Early-Onset	Parkinson disease	BEFREE	29166608		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	GWASCAT_DG	26974007		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	30227269		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	22373040		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	22373040		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	Pubtator	22373040	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Squamous cell carcinoma	Carcinoma	BEFREE	11511096		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	33282955	Associate	★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	GWASCAT_DG	26974007		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	20193846	Associate	★☆☆☆☆ Found in Text Mining only