Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	22891
Gene name	Zinc finger protein 365
Gene symbol	ZNF365
Synonyms (NCBI Gene)	Su48UANZNF365D
Chromosome	10
Chromosome location	10q21.2
Summary	This gene encodes a zinc finger protein that may play a role in the repair of DNA damage and maintenance of genome stability. The N-terminal C2H2 zinc finger motif is required to form a protein complex with PARP1 and MRE11, which are known to be involved

139

Show/Hide all (139)

miRTarBase ID	miRNA	Experiments	Reference
MIRT016433	hsa-miR-193b-3p	Microarray	20304954
MIRT025758	hsa-miR-7-5p	Microarray	17612493
MIRT437691	hsa-miR-223-3p	MicroarrayqRT-PCR	22815788
MIRT1523164	hsa-miR-1299	CLIP-seq
MIRT1523165	hsa-miR-3182	CLIP-seq
MIRT1523166	hsa-miR-3686	CLIP-seq
MIRT1523167	hsa-miR-875-3p	CLIP-seq
MIRT1523168	hsa-miR-1233	CLIP-seq
MIRT1523169	hsa-miR-1266	CLIP-seq
MIRT1523170	hsa-miR-129-3p	CLIP-seq
MIRT1523171	hsa-miR-1294	CLIP-seq
MIRT1523172	hsa-miR-1304	CLIP-seq
MIRT1523173	hsa-miR-132	CLIP-seq
MIRT1523174	hsa-miR-1343	CLIP-seq
MIRT1523175	hsa-miR-140-5p	CLIP-seq
MIRT1523176	hsa-miR-186	CLIP-seq
MIRT1523177	hsa-miR-200b	CLIP-seq
MIRT1523178	hsa-miR-200c	CLIP-seq
MIRT1523179	hsa-miR-21	CLIP-seq
MIRT1523180	hsa-miR-212	CLIP-seq
MIRT1523181	hsa-miR-3133	CLIP-seq
MIRT1523182	hsa-miR-3143	CLIP-seq
MIRT1523183	hsa-miR-3156-5p	CLIP-seq
MIRT1523184	hsa-miR-3165	CLIP-seq
MIRT1523185	hsa-miR-323-5p	CLIP-seq
MIRT1523186	hsa-miR-3646	CLIP-seq
MIRT1523187	hsa-miR-3650	CLIP-seq
MIRT1523188	hsa-miR-3662	CLIP-seq
MIRT1523189	hsa-miR-3664-3p	CLIP-seq
MIRT1523190	hsa-miR-3682-5p	CLIP-seq
MIRT1523191	hsa-miR-3688-5p	CLIP-seq
MIRT1523192	hsa-miR-374c	CLIP-seq
MIRT1523193	hsa-miR-3919	CLIP-seq
MIRT1523194	hsa-miR-409-5p	CLIP-seq
MIRT1523195	hsa-miR-4269	CLIP-seq
MIRT1523196	hsa-miR-429	CLIP-seq
MIRT1523197	hsa-miR-4303	CLIP-seq
MIRT1523198	hsa-miR-4316	CLIP-seq
MIRT1523199	hsa-miR-4423-5p	CLIP-seq
MIRT1523200	hsa-miR-4428	CLIP-seq
MIRT1523201	hsa-miR-4455	CLIP-seq
MIRT1523202	hsa-miR-4481	CLIP-seq
MIRT1523203	hsa-miR-4514	CLIP-seq
MIRT1523204	hsa-miR-4518	CLIP-seq
MIRT1523205	hsa-miR-4668-5p	CLIP-seq
MIRT1523206	hsa-miR-4677-3p	CLIP-seq
MIRT1523207	hsa-miR-4679	CLIP-seq
MIRT1523208	hsa-miR-4682	CLIP-seq
MIRT1523209	hsa-miR-4692	CLIP-seq
MIRT1523210	hsa-miR-4711-3p	CLIP-seq
MIRT1523211	hsa-miR-4742-5p	CLIP-seq
MIRT1523212	hsa-miR-4745-5p	CLIP-seq
MIRT1523213	hsa-miR-4756-3p	CLIP-seq
MIRT1523214	hsa-miR-4758-5p	CLIP-seq
MIRT1523215	hsa-miR-4790-3p	CLIP-seq
MIRT1523216	hsa-miR-509-3p	CLIP-seq
MIRT1523217	hsa-miR-543	CLIP-seq
MIRT1523218	hsa-miR-555	CLIP-seq
MIRT1523219	hsa-miR-590-5p	CLIP-seq
MIRT1523220	hsa-miR-605	CLIP-seq
MIRT1523221	hsa-miR-609	CLIP-seq
MIRT1523222	hsa-miR-640	CLIP-seq
MIRT1523223	hsa-miR-655	CLIP-seq
MIRT1523224	hsa-miR-876-3p	CLIP-seq
MIRT1523225	hsa-miR-891b	CLIP-seq
MIRT1523226	hsa-miR-944	CLIP-seq
MIRT1523166	hsa-miR-3686	CLIP-seq
MIRT2158089	hsa-miR-4752	CLIP-seq
MIRT2377671	hsa-miR-15a	CLIP-seq
MIRT2377672	hsa-miR-15b	CLIP-seq
MIRT2377673	hsa-miR-16	CLIP-seq
MIRT2377674	hsa-miR-195	CLIP-seq
MIRT2377675	hsa-miR-214	CLIP-seq
MIRT2377676	hsa-miR-2681	CLIP-seq
MIRT2377677	hsa-miR-298	CLIP-seq
MIRT2377678	hsa-miR-3609	CLIP-seq
MIRT2377679	hsa-miR-3617	CLIP-seq
MIRT2377680	hsa-miR-3619-5p	CLIP-seq
MIRT2377681	hsa-miR-3973	CLIP-seq
MIRT2377682	hsa-miR-424	CLIP-seq
MIRT2377683	hsa-miR-4459	CLIP-seq
MIRT2377684	hsa-miR-4527	CLIP-seq
MIRT2377685	hsa-miR-4641	CLIP-seq
MIRT2377686	hsa-miR-4699-5p	CLIP-seq
MIRT2377687	hsa-miR-4722-5p	CLIP-seq
MIRT2377688	hsa-miR-497	CLIP-seq
MIRT2377689	hsa-miR-510	CLIP-seq
MIRT2377690	hsa-miR-512-5p	CLIP-seq
MIRT2377691	hsa-miR-520g	CLIP-seq
MIRT2377692	hsa-miR-520h	CLIP-seq
MIRT2377693	hsa-miR-548ah	CLIP-seq
MIRT2377694	hsa-miR-641	CLIP-seq
MIRT2377695	hsa-miR-761	CLIP-seq
MIRT2441820	hsa-miR-3622a-3p	CLIP-seq
MIRT2441821	hsa-miR-3622b-3p	CLIP-seq
MIRT2441822	hsa-miR-5096	CLIP-seq
MIRT2441823	hsa-miR-511	CLIP-seq
MIRT2670000	hsa-miR-1193	CLIP-seq
MIRT2670001	hsa-miR-1273	CLIP-seq
MIRT2670002	hsa-miR-193a-3p	CLIP-seq
MIRT2670003	hsa-miR-193b	CLIP-seq
MIRT2670004	hsa-miR-2115	CLIP-seq
MIRT2670005	hsa-miR-2392	CLIP-seq
MIRT2670006	hsa-miR-3117-5p	CLIP-seq
MIRT2670007	hsa-miR-3158-3p	CLIP-seq
MIRT2670008	hsa-miR-4496	CLIP-seq
MIRT2670009	hsa-miR-455-3p	CLIP-seq
MIRT2670010	hsa-miR-4743	CLIP-seq
MIRT2670011	hsa-miR-501-3p	CLIP-seq
MIRT2670012	hsa-miR-502-3p	CLIP-seq
MIRT2670013	hsa-miR-516a-3p	CLIP-seq
MIRT2670014	hsa-miR-520f	CLIP-seq
MIRT2670015	hsa-miR-665	CLIP-seq
MIRT2670016	hsa-miR-767-5p	CLIP-seq
MIRT2670000	hsa-miR-1193	CLIP-seq
MIRT2670001	hsa-miR-1273	CLIP-seq
MIRT2670002	hsa-miR-193a-3p	CLIP-seq
MIRT2670003	hsa-miR-193b	CLIP-seq
MIRT2670004	hsa-miR-2115	CLIP-seq
MIRT2670005	hsa-miR-2392	CLIP-seq
MIRT2670006	hsa-miR-3117-5p	CLIP-seq
MIRT2670007	hsa-miR-3158-3p	CLIP-seq
MIRT2695976	hsa-miR-3173-3p	CLIP-seq
MIRT2695977	hsa-miR-3612	CLIP-seq
MIRT1523200	hsa-miR-4428	CLIP-seq
MIRT2670008	hsa-miR-4496	CLIP-seq
MIRT2695978	hsa-miR-4521	CLIP-seq
MIRT2695979	hsa-miR-4695-5p	CLIP-seq
MIRT2670010	hsa-miR-4743	CLIP-seq
MIRT2670011	hsa-miR-501-3p	CLIP-seq
MIRT2670012	hsa-miR-502-3p	CLIP-seq
MIRT2695980	hsa-miR-513a-3p	CLIP-seq
MIRT2670013	hsa-miR-516a-3p	CLIP-seq
MIRT2670014	hsa-miR-520f	CLIP-seq
MIRT2695981	hsa-miR-593	CLIP-seq
MIRT2695982	hsa-miR-650	CLIP-seq
MIRT2695983	hsa-miR-654-3p	CLIP-seq
MIRT2670015	hsa-miR-665	CLIP-seq
MIRT2670016	hsa-miR-767-5p	CLIP-seq

Show/Hide all (29)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000281	Process	Mitotic cytokinesis	IMP	16617106
GO:0000723	Process	Telomere maintenance	IBA
GO:0000723	Process	Telomere maintenance	IEA
GO:0000723	Process	Telomere maintenance	IMP	23776040
GO:0005515	Function	Protein binding	IPI	16682949, 17389905, 23966166
GO:0005737	Component	Cytoplasm	IEA
GO:0005813	Component	Centrosome	IDA	16617106
GO:0005813	Component	Centrosome	IEA
GO:0005856	Component	Cytoskeleton	IEA
GO:0007399	Process	Nervous system development	IEA
GO:0008270	Function	Zinc ion binding	IEA
GO:0010569	Process	Regulation of double-strand break repair via homologous recombination	IBA
GO:0010569	Process	Regulation of double-strand break repair via homologous recombination	IMP	23966166
GO:0010975	Process	Regulation of neuron projection development	IBA
GO:0010977	Process	Negative regulation of neuron projection development	IDA	17389905
GO:0021687	Process	Cerebellar molecular layer morphogenesis	IEA
GO:0021687	Process	Cerebellar molecular layer morphogenesis	ISS
GO:0033566	Process	Gamma-tubulin complex localization	IMP	16617106
GO:0042802	Function	Identical protein binding	IPI	16617106
GO:0042803	Function	Protein homodimerization activity	IDA	16617106
GO:0046872	Function	Metal ion binding	IEA
GO:0048714	Process	Positive regulation of oligodendrocyte differentiation	IEA
GO:0048714	Process	Positive regulation of oligodendrocyte differentiation	ISS
GO:0060997	Process	Dendritic spine morphogenesis	IEA
GO:0060997	Process	Dendritic spine morphogenesis	ISS
GO:0110026	Process	Regulation of DNA strand resection involved in replication fork processing	IBA
GO:0110026	Process	Regulation of DNA strand resection involved in replication fork processing	IMP	23966166
GO:0140059	Process	Dendrite arborization	IEA
GO:0140059	Process	Dendrite arborization	ISS

MIM	HGNC	e!Ensembl
607818	18194	ENSG00000138311

Q70YC4

Protein name

Talanin

Protein function

May play a role in uric acid excretion.

Family and domains

Tissue specificity

TISSUE SPECIFICITY: Isoform 4 is expressed in placenta, lung, kidney and pancreas. {ECO:0000269|PubMed:12740763}.

Sequence

MSALGQITITVSRCWNTERNQTDKNPCLHGAYLQLRETVKNKSTHLKKPLMKQAPPWKDH
LTFQPLHPAERKTQVWRWQSGNSSDLETTSSASPWPTGSNRDVVLNTLAESCCGLSELIT
APPYAGVSIQGFSQIWVLFPFCGGTFHHNEKDVLGLQDFERESVSTSQSRNISLLTLGQL
QNCVIGKLTIIDLLTEHLLGVRHGVICFPWGLPSSS

Sequence length

216

Q70YC5

Protein name

Protein ZNF365 (DISC1-binding zinc-finger protein) (Protein su48)

Protein function

Involved in the regulation of neurogenesis. Negatively regulates neurite outgrowth (PubMed:17389905). Involved in the morphogenesis of basket cells in the somatosensory cortex during embryogenesis. Involved in the positive regulation of oligoden

Family and domains

Tissue specificity

TISSUE SPECIFICITY: Isoform 1 is expressed in brain. Isoform 2 is expressed in placenta and at low level in lung and liver. Isoform 3 is expressed in kidney and pancreas. Isoform 1 is expressed exclusively in brain (PubMed:17389905). {ECO:0000269|PubMed:1

Sequence

MQQKAFEESRYPWQESFENVAVCLPLRCPRCGDHTRFRSLSSLRAHLEFSHSYEERTLLT
KCSLFPSLKDTDLVTSSELLKPGKLQSSGNVVKQKPSYVNLYSISHEHSKDRKPFEVVAE
RPVSYVQTYTAMDLHADSLDGTRSGPGLPTSDTKASFEAHVREKFNRMVEAVDRTIEKRI
DKLTKELAQKTAELLEVRAAFVQLTQKKQEVQRRERALNRQVDVAVEMIAVLRQRLTESE
EELLRKEEEVVTFNHFLEAAAEKEVQGKARLQDFIENLLQRVELAEKQLEYYQSQQASGF
VRDLSGHVLTDISSNRKPKCLSRGHPHSVCNHPDLKAHFHPKGRNHLKKAKDDRASMQPA
KAIHEQAESSRDLCRPPKKGELLGFGRKGNIRPKMAKKKPTAIVNII

Sequence length

407

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (14)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
BREAST CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CENTRAL NERVOUS SYSTEM CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DERMATITIS, ATOPIC	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESTROGEN-RECEPTOR NEGATIVE BREAST CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESTROGEN-RECEPTOR POSITIVE BREAST CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NARCOLEPSY TYPE 1	—	Disgenet, Orphanet Disgenet, Orphanet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NARCOLEPSY TYPE 2	—	Orphanet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NARCOLEPSY WITHOUT CATAPLEXY	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nephrolithiasis, uric acid, susceptibility to	Benign	ClinVar CTD, ClinVar CTD, ClinVar	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
SCHIZOPHRENIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
URIC ACID UROLITHIASIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (67)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Amnesia, Transient Global	Amnesia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Aneuploidy	Aneuploidy	Pubtator	23776040	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ankylosing spondylitis	Ankylosing Spondylitis	GWASCAT_DG	26974007		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	GWASCAT_DG	30929738		★★★★★ ★☆☆☆☆ Found in Text Mining only
Basal Cell Cancer	Basal Cell Neoplasm	GWASCAT_DG	28177523, 31174203		★★★★★ ★☆☆☆☆ Found in Text Mining only
Basal cell carcinoma	Carcinoma	GWASCAT_DG	28177523, 31174203		★★★★★ ★☆☆☆☆ Found in Text Mining only
Basal Cell Neoplasm	Basal Cell Neoplasm	GWASCAT_DG	28177523, 31174203		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	19191256		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	GWASCAT_DG	20453838, 21908515, 23535729, 23535733, 25751625, 29059683		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Carcinoma	Breast Carcinoma	BEFREE	21060860, 21278746, 21908515, 22348646, 22351618, 22747683, 23966166, 25012995, 25329322, 26073781, 27432265		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Carcinoma	Breast Carcinoma	CTD_human_DG	21278746		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	21060860, 21908515, 22348646, 22351618, 22747683, 24528085, 24722754, 24743323, 25329322, 25862352, 26036842, 26073781, 27863437, 38094285	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	22351618		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cataplexy	Cataplexy	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood asthma	Asthma	GWASCAT_DG	30929738		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangitis, Sclerosing	Cholangitis	GWASCAT_DG	26974007		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	21818367, 21830272	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Diseases	Colonic disease	Pubtator	21830272	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	20222910, 21257989, 21818367, 21830272, 24365559, 25489960		★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	21257989, 21818367, 21830272, 25489960, 28300425, 30500874	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	GWASDB_DG	22412388		★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	GWASCAT_DG	22412388, 26974007		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	GWASDB_DG	21666691, 23042114		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dermatitis, Atopic	Dermatitis	BEFREE	23042114		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dermatitis, Atopic	Dermatitis	GWASCAT_DG	23042114, 26482879		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dermatitis, Atopic	Dermatitis	CTD_human_DG	23042114		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Eczema	Eczema	BEFREE	23042114		★★★★★ ★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	GWASCAT_DG	30595370		★★★★★ ★☆☆☆☆ Found in Text Mining only
Eczema, Infantile	Eczema	CTD_human_DG	23042114		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hallucinations	Hallucinations	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperuricemia	Hyperuricemia	BEFREE	15363853		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intracranial Aneurysm	Intracranial Aneurysm	BEFREE	31072845		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	GWASDB_DG	20453838, 21908515, 23535729, 23535733		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	21060860, 21278746, 21908515, 22348646, 22351618, 22747683, 23966166, 25012995, 25329322, 26073781, 27432265		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	CTD_human_DG	21278746		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	22351618		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	23776040		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Carcinoma, Human	Marfan Syndrome	CTD_human_DG	21278746		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	CTD_human_DG	21278746		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms, Human	Mammary Neoplasms	CTD_human_DG	21278746		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental disorders	Mental Disorders	BEFREE	17664024, 19958095		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	25060549		★★★★★ ★☆☆☆☆ Found in Text Mining only
Narcolepsy	Narcolepsy	GWASCAT_DG	23459209, 24204295		★★★★★ ★☆☆☆☆ Found in Text Mining only
Narcolepsy	Narcolepsy	GWASDB_DG	24204295		★★★★★ ★☆☆☆☆ Found in Text Mining only
Narcolepsy	Narcolepsy	ORPHANET_DG	24204295		★★★★★ ★☆☆☆☆ Found in Text Mining only
Narcolepsy	Narcolepsy	Pubtator	24204295	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Narcolepsy type 1	Narcolepsy	Orphanet			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Narcolepsy type 2	Narcolepsy	Orphanet			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Narcolepsy-Cataplexy Syndrome	Narcolepsy-Cataplexy Syndrome	ORPHANET_DG	24204295		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	22351618		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Oestrogen receptor positive breast cancer	Oestrogen Receptor Positive Breast Cancer	BEFREE	22351618		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	22351618		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	22351618	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	GWASDB_DG	22482804		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	GWASCAT_DG	26974007, 28537254		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	17664024, 19191256, 21853134		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	GWASCAT_DG	28991256, 30285260, 31374203		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Telomeric 22q13 Monosomy Syndrome	22q13 monosomy syndrome	Pubtator	23776040	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	27863437	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	21818367		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	GWASCAT_DG	26974007		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uric acid renal calculus	Uric Acid Renal Calculus	BEFREE	15363853		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uric acid urolithiasis	Uric Acid Urolithiasis	BEFREE	15363853		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Urolithiasis	Urolithiasis	BEFREE	25060549		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uveomeningoencephalitic Syndrome	Uveomeningoencephalitic Syndrome	BEFREE	25108386, 26628628		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uveomeningoencephalitic Syndrome	Uveomeningoencephalitic syndrome	Pubtator	32437414	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

ZNF365 (zinc finger protein 365)