Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	2289
Gene name	FKBP prolyl isomerase 5
Gene symbol	FKBP5
Synonyms (NCBI Gene)	AIG6FKBP51FKBP54P54PPIasePtg-10
Chromosome	6
Chromosome location	6p21.31
Summary	The protein encoded by this gene is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. This encoded protein is a cis-trans prolyl isomerase that binds

Show/Hide all (1)

SNP ID	Visualize variation	Clinical significance	Consequence
rs4713916	A>C,G,T	Drug-response	Genic upstream transcript variant, intron variant

447

Show/Hide all (447)

miRTarBase ID	miRNA	Experiments	Reference
MIRT030843	hsa-miR-21-5p	Microarray	18591254
MIRT050456	hsa-miR-22-3p	CLASH	23622248
MIRT043776	hsa-miR-328-3p	CLASH	23622248
MIRT038745	hsa-miR-93-3p	CLASH	23622248
MIRT437605	hsa-miR-100-5p	FACSLuciferase reporter assayqRT-PCRWestern blot	24030073
MIRT437605	hsa-miR-100-5p	FACSLuciferase reporter assayqRT-PCRWestern blot	24030073
MIRT437608	hsa-miR-99a-5p	FACSLuciferase reporter assayqRT-PCRWestern blot	24030073
MIRT437608	hsa-miR-99a-5p	FACSLuciferase reporter assayqRT-PCRWestern blot	24030073
MIRT668337	hsa-miR-4485-5p	HITS-CLIP	23824327
MIRT668336	hsa-miR-660-3p	HITS-CLIP	23824327
MIRT668335	hsa-miR-939-3p	HITS-CLIP	23824327
MIRT668334	hsa-miR-6852-5p	HITS-CLIP	23824327
MIRT668333	hsa-miR-6742-3p	HITS-CLIP	23824327
MIRT668332	hsa-miR-1281	HITS-CLIP	23824327
MIRT668331	hsa-miR-6791-3p	HITS-CLIP	23824327
MIRT668330	hsa-miR-6829-3p	HITS-CLIP	23824327
MIRT668329	hsa-miR-23a-5p	HITS-CLIP	23824327
MIRT668328	hsa-miR-23b-5p	HITS-CLIP	23824327
MIRT668327	hsa-miR-1343-3p	HITS-CLIP	23824327
MIRT668326	hsa-miR-6783-3p	HITS-CLIP	23824327
MIRT537342	hsa-miR-8080	PAR-CLIP	22012620
MIRT537340	hsa-miR-6816-3p	PAR-CLIP	22012620
MIRT537341	hsa-miR-3169	PAR-CLIP	22012620
MIRT537339	hsa-miR-4272	PAR-CLIP	22012620
MIRT537338	hsa-miR-4740-5p	PAR-CLIP	22012620
MIRT537337	hsa-miR-4666a-5p	PAR-CLIP	22012620
MIRT514720	hsa-miR-512-5p	PAR-CLIP	23446348
MIRT514719	hsa-miR-510-5p	PAR-CLIP	23446348
MIRT514718	hsa-miR-5690	PAR-CLIP	23446348
MIRT514717	hsa-miR-3664-3p	PAR-CLIP	23446348
MIRT514716	hsa-miR-3166	PAR-CLIP	23446348
MIRT514715	hsa-miR-7977	PAR-CLIP	23446348
MIRT452010	hsa-miR-4779	PAR-CLIP	23592263
MIRT452011	hsa-miR-6760-5p	PAR-CLIP	23592263
MIRT452009	hsa-miR-1321	PAR-CLIP	23592263
MIRT452008	hsa-miR-4739	PAR-CLIP	23592263
MIRT452007	hsa-miR-4756-5p	PAR-CLIP	23592263
MIRT452006	hsa-miR-4270	PAR-CLIP	23592263
MIRT452005	hsa-miR-4441	PAR-CLIP	23592263
MIRT452004	hsa-miR-6754-5p	PAR-CLIP	23592263
MIRT452003	hsa-miR-539-5p	PAR-CLIP	23592263
MIRT452002	hsa-miR-4419a	PAR-CLIP	23592263
MIRT452001	hsa-miR-4510	PAR-CLIP	23592263
MIRT452000	hsa-miR-6127	PAR-CLIP	23592263
MIRT451999	hsa-miR-6129	PAR-CLIP	23592263
MIRT451998	hsa-miR-6130	PAR-CLIP	23592263
MIRT451996	hsa-miR-6133	PAR-CLIP	23592263
MIRT451997	hsa-miR-765	PAR-CLIP	23592263
MIRT451995	hsa-miR-1249-5p	PAR-CLIP	23592263
MIRT451994	hsa-miR-6797-5p	PAR-CLIP	23592263
MIRT451993	hsa-miR-6878-5p	PAR-CLIP	23592263
MIRT451992	hsa-miR-7106-5p	PAR-CLIP	23592263
MIRT451991	hsa-miR-302c-5p	PAR-CLIP	23592263
MIRT451990	hsa-miR-200b-3p	PAR-CLIP	23592263
MIRT451989	hsa-miR-200c-3p	PAR-CLIP	23592263
MIRT451988	hsa-miR-429	PAR-CLIP	23592263
MIRT451987	hsa-miR-3654	PAR-CLIP	23592263
MIRT451986	hsa-miR-1243	PAR-CLIP	23592263
MIRT451985	hsa-miR-1910-3p	PAR-CLIP	23592263
MIRT451984	hsa-miR-6511a-5p	PAR-CLIP	23592263
MIRT451983	hsa-miR-4257	PAR-CLIP	23592263
MIRT451982	hsa-miR-5186	PAR-CLIP	23592263
MIRT451981	hsa-miR-4537	PAR-CLIP	23592263
MIRT451980	hsa-miR-1827	PAR-CLIP	23592263
MIRT451979	hsa-miR-377-5p	PAR-CLIP	23592263
MIRT451978	hsa-miR-6086	PAR-CLIP	23592263
MIRT451977	hsa-miR-2467-3p	PAR-CLIP	23592263
MIRT451976	hsa-miR-6499-3p	PAR-CLIP	23592263
MIRT451975	hsa-miR-3612	PAR-CLIP	23592263
MIRT451974	hsa-miR-650	PAR-CLIP	23592263
MIRT451973	hsa-miR-455-3p	PAR-CLIP	23592263
MIRT451972	hsa-miR-4443	PAR-CLIP	23592263
MIRT451971	hsa-miR-550b-2-5p	PAR-CLIP	23592263
MIRT451970	hsa-miR-6516-5p	PAR-CLIP	23592263
MIRT731709	hsa-miR-511-5p	Luciferase reporter assayqRT-PCR	27334923
MIRT731709	hsa-miR-511-5p	Luciferase reporter assayqRT-PCR	27334923
MIRT668337	hsa-miR-4485-5p	HITS-CLIP	23824327
MIRT668336	hsa-miR-660-3p	HITS-CLIP	23824327
MIRT668335	hsa-miR-939-3p	HITS-CLIP	23824327
MIRT668334	hsa-miR-6852-5p	HITS-CLIP	23824327
MIRT668333	hsa-miR-6742-3p	HITS-CLIP	23824327
MIRT668332	hsa-miR-1281	HITS-CLIP	23824327
MIRT668331	hsa-miR-6791-3p	HITS-CLIP	23824327
MIRT668330	hsa-miR-6829-3p	HITS-CLIP	23824327
MIRT668329	hsa-miR-23a-5p	HITS-CLIP	23824327
MIRT668328	hsa-miR-23b-5p	HITS-CLIP	23824327
MIRT668327	hsa-miR-1343-3p	HITS-CLIP	23824327
MIRT668326	hsa-miR-6783-3p	HITS-CLIP	23824327
MIRT537342	hsa-miR-8080	PAR-CLIP	22012620
MIRT537340	hsa-miR-6816-3p	PAR-CLIP	22012620
MIRT537341	hsa-miR-3169	PAR-CLIP	22012620
MIRT537339	hsa-miR-4272	PAR-CLIP	22012620
MIRT537338	hsa-miR-4740-5p	PAR-CLIP	22012620
MIRT537337	hsa-miR-4666a-5p	PAR-CLIP	22012620
MIRT514720	hsa-miR-512-5p	PAR-CLIP	23446348
MIRT514719	hsa-miR-510-5p	PAR-CLIP	23446348
MIRT514718	hsa-miR-5690	PAR-CLIP	23446348
MIRT514717	hsa-miR-3664-3p	PAR-CLIP	23446348
MIRT514716	hsa-miR-3166	PAR-CLIP	23446348
MIRT514715	hsa-miR-7977	PAR-CLIP	23446348
MIRT452010	hsa-miR-4779	PAR-CLIP	23592263
MIRT452011	hsa-miR-6760-5p	PAR-CLIP	23592263
MIRT452009	hsa-miR-1321	PAR-CLIP	23592263
MIRT452008	hsa-miR-4739	PAR-CLIP	23592263
MIRT452007	hsa-miR-4756-5p	PAR-CLIP	23592263
MIRT452006	hsa-miR-4270	PAR-CLIP	23592263
MIRT452005	hsa-miR-4441	PAR-CLIP	23592263
MIRT452004	hsa-miR-6754-5p	PAR-CLIP	23592263
MIRT452003	hsa-miR-539-5p	PAR-CLIP	23592263
MIRT452002	hsa-miR-4419a	PAR-CLIP	23592263
MIRT452001	hsa-miR-4510	PAR-CLIP	23592263
MIRT452000	hsa-miR-6127	PAR-CLIP	23592263
MIRT451999	hsa-miR-6129	PAR-CLIP	23592263
MIRT451998	hsa-miR-6130	PAR-CLIP	23592263
MIRT451996	hsa-miR-6133	PAR-CLIP	23592263
MIRT451997	hsa-miR-765	PAR-CLIP	23592263
MIRT451995	hsa-miR-1249-5p	PAR-CLIP	23592263
MIRT451994	hsa-miR-6797-5p	PAR-CLIP	23592263
MIRT451993	hsa-miR-6878-5p	PAR-CLIP	23592263
MIRT451992	hsa-miR-7106-5p	PAR-CLIP	23592263
MIRT451991	hsa-miR-302c-5p	PAR-CLIP	23592263
MIRT451990	hsa-miR-200b-3p	PAR-CLIP	23592263
MIRT451989	hsa-miR-200c-3p	PAR-CLIP	23592263
MIRT451988	hsa-miR-429	PAR-CLIP	23592263
MIRT451987	hsa-miR-3654	PAR-CLIP	23592263
MIRT451986	hsa-miR-1243	PAR-CLIP	23592263
MIRT451985	hsa-miR-1910-3p	PAR-CLIP	23592263
MIRT451984	hsa-miR-6511a-5p	PAR-CLIP	23592263
MIRT451983	hsa-miR-4257	PAR-CLIP	23592263
MIRT451982	hsa-miR-5186	PAR-CLIP	23592263
MIRT451981	hsa-miR-4537	PAR-CLIP	23592263
MIRT451980	hsa-miR-1827	PAR-CLIP	23592263
MIRT451979	hsa-miR-377-5p	PAR-CLIP	23592263
MIRT451978	hsa-miR-6086	PAR-CLIP	23592263
MIRT451977	hsa-miR-2467-3p	PAR-CLIP	23592263
MIRT451976	hsa-miR-6499-3p	PAR-CLIP	23592263
MIRT451975	hsa-miR-3612	PAR-CLIP	23592263
MIRT451974	hsa-miR-650	PAR-CLIP	23592263
MIRT451973	hsa-miR-455-3p	PAR-CLIP	23592263
MIRT451972	hsa-miR-4443	PAR-CLIP	23592263
MIRT451971	hsa-miR-550b-2-5p	PAR-CLIP	23592263
MIRT451970	hsa-miR-6516-5p	PAR-CLIP	23592263
MIRT755358	hsa-miR-340-3p	Luciferase reporter assayWestern blottingqRT-PCR	36769373
MIRT997558	hsa-miR-1261	CLIP-seq
MIRT997559	hsa-miR-147	CLIP-seq
MIRT997560	hsa-miR-1470	CLIP-seq
MIRT997561	hsa-miR-15a	CLIP-seq
MIRT997562	hsa-miR-15b	CLIP-seq
MIRT997563	hsa-miR-16	CLIP-seq
MIRT997564	hsa-miR-1909	CLIP-seq
MIRT997565	hsa-miR-1915	CLIP-seq
MIRT997566	hsa-miR-195	CLIP-seq
MIRT997567	hsa-miR-203	CLIP-seq
MIRT997568	hsa-miR-208a	CLIP-seq
MIRT997569	hsa-miR-208b	CLIP-seq
MIRT997570	hsa-miR-2115	CLIP-seq
MIRT997571	hsa-miR-214	CLIP-seq
MIRT997572	hsa-miR-219-2-3p	CLIP-seq
MIRT997573	hsa-miR-2964a-3p	CLIP-seq
MIRT997574	hsa-miR-3117-5p	CLIP-seq
MIRT997575	hsa-miR-3140-5p	CLIP-seq
MIRT997576	hsa-miR-3150a-3p	CLIP-seq
MIRT997577	hsa-miR-3157-3p	CLIP-seq
MIRT997578	hsa-miR-3160-3p	CLIP-seq
MIRT997579	hsa-miR-3175	CLIP-seq
MIRT997580	hsa-miR-3180-5p	CLIP-seq
MIRT997581	hsa-miR-3190	CLIP-seq
MIRT997582	hsa-miR-320e	CLIP-seq
MIRT997583	hsa-miR-3529	CLIP-seq
MIRT997584	hsa-miR-361-3p	CLIP-seq
MIRT997585	hsa-miR-3619-5p	CLIP-seq
MIRT997586	hsa-miR-3658	CLIP-seq
MIRT997587	hsa-miR-375	CLIP-seq
MIRT997588	hsa-miR-376c	CLIP-seq
MIRT997589	hsa-miR-378	CLIP-seq
MIRT997590	hsa-miR-378b	CLIP-seq
MIRT997591	hsa-miR-378c	CLIP-seq
MIRT997592	hsa-miR-378d	CLIP-seq
MIRT997593	hsa-miR-378e	CLIP-seq
MIRT997594	hsa-miR-378f	CLIP-seq
MIRT997595	hsa-miR-378h	CLIP-seq
MIRT997596	hsa-miR-378i	CLIP-seq
MIRT997597	hsa-miR-379	CLIP-seq
MIRT997598	hsa-miR-3911	CLIP-seq
MIRT997599	hsa-miR-3977	CLIP-seq
MIRT997600	hsa-miR-422a	CLIP-seq
MIRT997601	hsa-miR-424	CLIP-seq
MIRT997602	hsa-miR-4432	CLIP-seq
MIRT997603	hsa-miR-4438	CLIP-seq
MIRT997604	hsa-miR-4451	CLIP-seq
MIRT997605	hsa-miR-4487	CLIP-seq
MIRT997606	hsa-miR-4536	CLIP-seq
MIRT997607	hsa-miR-4635	CLIP-seq
MIRT997608	hsa-miR-4639-3p	CLIP-seq
MIRT997609	hsa-miR-4643	CLIP-seq
MIRT997610	hsa-miR-4650-3p	CLIP-seq
MIRT997611	hsa-miR-4652-3p	CLIP-seq
MIRT997612	hsa-miR-4659a-5p	CLIP-seq
MIRT997613	hsa-miR-4659b-5p	CLIP-seq
MIRT997614	hsa-miR-466	CLIP-seq
MIRT997615	hsa-miR-4666-5p	CLIP-seq
MIRT997616	hsa-miR-4667-5p	CLIP-seq
MIRT997617	hsa-miR-4675	CLIP-seq
MIRT997618	hsa-miR-4680-3p	CLIP-seq
MIRT997619	hsa-miR-4687-3p	CLIP-seq
MIRT997620	hsa-miR-4700-5p	CLIP-seq
MIRT997621	hsa-miR-4725-5p	CLIP-seq
MIRT997622	hsa-miR-4738-3p	CLIP-seq
MIRT997623	hsa-miR-4741	CLIP-seq
MIRT997624	hsa-miR-4747-5p	CLIP-seq
MIRT997625	hsa-miR-4776-3p	CLIP-seq
MIRT997626	hsa-miR-4789-3p	CLIP-seq
MIRT997627	hsa-miR-493	CLIP-seq
MIRT997628	hsa-miR-495	CLIP-seq
MIRT997629	hsa-miR-497	CLIP-seq
MIRT997630	hsa-miR-499-5p	CLIP-seq
MIRT997631	hsa-miR-504	CLIP-seq
MIRT997632	hsa-miR-516a-3p	CLIP-seq
MIRT997633	hsa-miR-520a-5p	CLIP-seq
MIRT997634	hsa-miR-525-5p	CLIP-seq
MIRT997635	hsa-miR-556-5p	CLIP-seq
MIRT997636	hsa-miR-558	CLIP-seq
MIRT997637	hsa-miR-619	CLIP-seq
MIRT997638	hsa-miR-644	CLIP-seq
MIRT997639	hsa-miR-761	CLIP-seq
MIRT997640	hsa-miR-769-5p	CLIP-seq
MIRT997641	hsa-miR-874	CLIP-seq
MIRT997642	hsa-miR-939	CLIP-seq
MIRT997643	hsa-miR-122	CLIP-seq
MIRT997644	hsa-miR-1254	CLIP-seq
MIRT997645	hsa-miR-1262	CLIP-seq
MIRT997646	hsa-miR-127-5p	CLIP-seq
MIRT997647	hsa-miR-130a	CLIP-seq
MIRT997648	hsa-miR-130b	CLIP-seq
MIRT997649	hsa-miR-2110	CLIP-seq
MIRT997650	hsa-miR-301a	CLIP-seq
MIRT997651	hsa-miR-301b	CLIP-seq
MIRT997652	hsa-miR-3116	CLIP-seq
MIRT997576	hsa-miR-3150a-3p	CLIP-seq
MIRT997653	hsa-miR-3156-5p	CLIP-seq
MIRT997654	hsa-miR-337-3p	CLIP-seq
MIRT997655	hsa-miR-3666	CLIP-seq
MIRT997656	hsa-miR-3667-5p	CLIP-seq
MIRT997657	hsa-miR-3688-3p	CLIP-seq
MIRT997658	hsa-miR-3978	CLIP-seq
MIRT997659	hsa-miR-4261	CLIP-seq
MIRT997660	hsa-miR-4271	CLIP-seq
MIRT997661	hsa-miR-4295	CLIP-seq
MIRT997662	hsa-miR-4496	CLIP-seq
MIRT997663	hsa-miR-454	CLIP-seq
MIRT997664	hsa-miR-4637	CLIP-seq
MIRT997665	hsa-miR-4687-5p	CLIP-seq
MIRT997666	hsa-miR-4700-3p	CLIP-seq
MIRT997667	hsa-miR-4701-3p	CLIP-seq
MIRT997668	hsa-miR-4725-3p	CLIP-seq
MIRT997669	hsa-miR-4728-3p	CLIP-seq
MIRT997670	hsa-miR-4731-3p	CLIP-seq
MIRT997671	hsa-miR-4781-3p	CLIP-seq
MIRT997672	hsa-miR-4786-3p	CLIP-seq
MIRT997673	hsa-miR-4797-5p	CLIP-seq
MIRT997674	hsa-miR-4801	CLIP-seq
MIRT997675	hsa-miR-485-3p	CLIP-seq
MIRT997676	hsa-miR-491-3p	CLIP-seq
MIRT997677	hsa-miR-508-5p	CLIP-seq
MIRT997678	hsa-miR-539	CLIP-seq
MIRT997679	hsa-miR-542-3p	CLIP-seq
MIRT997680	hsa-miR-561	CLIP-seq
MIRT997681	hsa-miR-566	CLIP-seq
MIRT997682	hsa-miR-652	CLIP-seq
MIRT997683	hsa-miR-653	CLIP-seq
MIRT997684	hsa-miR-656	CLIP-seq
MIRT997685	hsa-miR-661	CLIP-seq
MIRT997686	hsa-miR-766	CLIP-seq
MIRT997687	hsa-miR-875-3p	CLIP-seq
MIRT997688	hsa-miR-889	CLIP-seq
MIRT997689	hsa-miR-1264	CLIP-seq
MIRT997690	hsa-miR-1278	CLIP-seq
MIRT997691	hsa-miR-1297	CLIP-seq
MIRT997692	hsa-miR-140-3p	CLIP-seq
MIRT997560	hsa-miR-1470	CLIP-seq
MIRT997693	hsa-miR-149	CLIP-seq
MIRT997561	hsa-miR-15a	CLIP-seq
MIRT997562	hsa-miR-15b	CLIP-seq
MIRT997563	hsa-miR-16	CLIP-seq
MIRT997564	hsa-miR-1909	CLIP-seq
MIRT997566	hsa-miR-195	CLIP-seq
MIRT997567	hsa-miR-203	CLIP-seq
MIRT997571	hsa-miR-214	CLIP-seq
MIRT997694	hsa-miR-24	CLIP-seq
MIRT997695	hsa-miR-26a	CLIP-seq
MIRT997696	hsa-miR-26b	CLIP-seq
MIRT997697	hsa-miR-3159	CLIP-seq
MIRT997578	hsa-miR-3160-3p	CLIP-seq
MIRT997582	hsa-miR-320e	CLIP-seq
MIRT997585	hsa-miR-3619-5p	CLIP-seq
MIRT997589	hsa-miR-378	CLIP-seq
MIRT997590	hsa-miR-378b	CLIP-seq
MIRT997591	hsa-miR-378c	CLIP-seq
MIRT997592	hsa-miR-378d	CLIP-seq
MIRT997593	hsa-miR-378e	CLIP-seq
MIRT997594	hsa-miR-378f	CLIP-seq
MIRT997595	hsa-miR-378h	CLIP-seq
MIRT997596	hsa-miR-378i	CLIP-seq
MIRT997600	hsa-miR-422a	CLIP-seq
MIRT997601	hsa-miR-424	CLIP-seq
MIRT997698	hsa-miR-4284	CLIP-seq
MIRT997699	hsa-miR-4465	CLIP-seq
MIRT997700	hsa-miR-4469	CLIP-seq
MIRT997605	hsa-miR-4487	CLIP-seq
MIRT997701	hsa-miR-451b	CLIP-seq
MIRT997702	hsa-miR-4667-3p	CLIP-seq
MIRT997617	hsa-miR-4675	CLIP-seq
MIRT997619	hsa-miR-4687-3p	CLIP-seq
MIRT997623	hsa-miR-4741	CLIP-seq
MIRT997703	hsa-miR-483-3p	CLIP-seq
MIRT997629	hsa-miR-497	CLIP-seq
MIRT997635	hsa-miR-556-5p	CLIP-seq
MIRT997636	hsa-miR-558	CLIP-seq
MIRT997704	hsa-miR-633	CLIP-seq
MIRT997639	hsa-miR-761	CLIP-seq
MIRT997644	hsa-miR-1254	CLIP-seq
MIRT997652	hsa-miR-3116	CLIP-seq
MIRT997684	hsa-miR-656	CLIP-seq
MIRT997685	hsa-miR-661	CLIP-seq
MIRT997688	hsa-miR-889	CLIP-seq
MIRT1995735	hsa-miR-4318	CLIP-seq
MIRT997701	hsa-miR-451b	CLIP-seq
MIRT1995736	hsa-miR-4693-5p	CLIP-seq
MIRT1995737	hsa-miR-4766-3p	CLIP-seq
MIRT1995738	hsa-miR-548aa	CLIP-seq
MIRT1995739	hsa-miR-548ag	CLIP-seq
MIRT1995740	hsa-miR-548ai	CLIP-seq
MIRT1995741	hsa-miR-548m	CLIP-seq
MIRT1995742	hsa-miR-548p	CLIP-seq
MIRT1995743	hsa-miR-892a	CLIP-seq
MIRT1995744	hsa-miR-1208	CLIP-seq
MIRT1995745	hsa-miR-3119	CLIP-seq
MIRT2388013	hsa-miR-1267	CLIP-seq
MIRT1995735	hsa-miR-4318	CLIP-seq
MIRT997611	hsa-miR-4652-3p	CLIP-seq
MIRT1995736	hsa-miR-4693-5p	CLIP-seq
MIRT997640	hsa-miR-769-5p	CLIP-seq
MIRT1995743	hsa-miR-892a	CLIP-seq
MIRT2449714	hsa-miR-1976	CLIP-seq
MIRT2449715	hsa-miR-2355-5p	CLIP-seq
MIRT2449716	hsa-miR-3151	CLIP-seq
MIRT2449717	hsa-miR-3165	CLIP-seq
MIRT2449718	hsa-miR-323b-3p	CLIP-seq
MIRT2449719	hsa-miR-3622a-3p	CLIP-seq
MIRT2449720	hsa-miR-3622b-3p	CLIP-seq
MIRT2449721	hsa-miR-3622b-5p	CLIP-seq
MIRT2449722	hsa-miR-3662	CLIP-seq
MIRT2449723	hsa-miR-3679-3p	CLIP-seq
MIRT2449724	hsa-miR-4279	CLIP-seq
MIRT2449725	hsa-miR-4433	CLIP-seq
MIRT2449726	hsa-miR-4446-5p	CLIP-seq
MIRT2449727	hsa-miR-4459	CLIP-seq
MIRT2449728	hsa-miR-4532	CLIP-seq
MIRT2449729	hsa-miR-4645-5p	CLIP-seq
MIRT2449730	hsa-miR-4673	CLIP-seq
MIRT2449731	hsa-miR-4716-5p	CLIP-seq
MIRT2449732	hsa-miR-4722-3p	CLIP-seq
MIRT2449733	hsa-miR-4738-5p	CLIP-seq
MIRT2449734	hsa-miR-4755-3p	CLIP-seq
MIRT2449735	hsa-miR-4768-3p	CLIP-seq
MIRT2449736	hsa-miR-4775	CLIP-seq
MIRT2449737	hsa-miR-544b	CLIP-seq
MIRT2449738	hsa-miR-552	CLIP-seq
MIRT2449739	hsa-miR-576-3p	CLIP-seq
MIRT2449740	hsa-miR-587	CLIP-seq
MIRT2449741	hsa-miR-590-3p	CLIP-seq
MIRT2533665	hsa-miR-1202	CLIP-seq
MIRT2533666	hsa-miR-1207-3p	CLIP-seq
MIRT2388013	hsa-miR-1267	CLIP-seq
MIRT2533667	hsa-miR-1270	CLIP-seq
MIRT997690	hsa-miR-1278	CLIP-seq
MIRT997691	hsa-miR-1297	CLIP-seq
MIRT997560	hsa-miR-1470	CLIP-seq
MIRT997561	hsa-miR-15a	CLIP-seq
MIRT997562	hsa-miR-15b	CLIP-seq
MIRT997563	hsa-miR-16	CLIP-seq
MIRT2533668	hsa-miR-193a-3p	CLIP-seq
MIRT2533669	hsa-miR-193b	CLIP-seq
MIRT997566	hsa-miR-195	CLIP-seq
MIRT997568	hsa-miR-208a	CLIP-seq
MIRT997569	hsa-miR-208b	CLIP-seq
MIRT997571	hsa-miR-214	CLIP-seq
MIRT997695	hsa-miR-26a	CLIP-seq
MIRT997696	hsa-miR-26b	CLIP-seq
MIRT2533670	hsa-miR-3064-5p	CLIP-seq
MIRT997574	hsa-miR-3117-5p	CLIP-seq
MIRT997576	hsa-miR-3150a-3p	CLIP-seq
MIRT997577	hsa-miR-3157-3p	CLIP-seq
MIRT997579	hsa-miR-3175	CLIP-seq
MIRT2533671	hsa-miR-3177-5p	CLIP-seq
MIRT997581	hsa-miR-3190	CLIP-seq
MIRT2533672	hsa-miR-3200-5p	CLIP-seq
MIRT2533673	hsa-miR-329	CLIP-seq
MIRT2533674	hsa-miR-331-3p	CLIP-seq
MIRT997585	hsa-miR-3619-5p	CLIP-seq
MIRT2533675	hsa-miR-362-3p	CLIP-seq
MIRT997586	hsa-miR-3658	CLIP-seq
MIRT2533676	hsa-miR-3673	CLIP-seq
MIRT2449723	hsa-miR-3679-3p	CLIP-seq
MIRT2533677	hsa-miR-369-3p	CLIP-seq
MIRT2533678	hsa-miR-374c	CLIP-seq
MIRT2533679	hsa-miR-377	CLIP-seq
MIRT2533680	hsa-miR-3941	CLIP-seq
MIRT2533681	hsa-miR-3972	CLIP-seq
MIRT997601	hsa-miR-424	CLIP-seq
MIRT2533682	hsa-miR-4276	CLIP-seq
MIRT2533683	hsa-miR-4286	CLIP-seq
MIRT2533684	hsa-miR-4299	CLIP-seq
MIRT1995735	hsa-miR-4318	CLIP-seq
MIRT2533685	hsa-miR-432	CLIP-seq
MIRT997602	hsa-miR-4432	CLIP-seq
MIRT997699	hsa-miR-4465	CLIP-seq
MIRT2533686	hsa-miR-4642	CLIP-seq
MIRT997609	hsa-miR-4643	CLIP-seq
MIRT997611	hsa-miR-4652-3p	CLIP-seq
MIRT997614	hsa-miR-466	CLIP-seq
MIRT997615	hsa-miR-4666-5p	CLIP-seq
MIRT997616	hsa-miR-4667-5p	CLIP-seq
MIRT2533687	hsa-miR-4682	CLIP-seq
MIRT2533688	hsa-miR-4683	CLIP-seq
MIRT997619	hsa-miR-4687-3p	CLIP-seq
MIRT1995736	hsa-miR-4693-5p	CLIP-seq
MIRT997620	hsa-miR-4700-5p	CLIP-seq
MIRT2533689	hsa-miR-4715-3p	CLIP-seq
MIRT2533690	hsa-miR-4720-5p	CLIP-seq
MIRT997624	hsa-miR-4747-5p	CLIP-seq
MIRT997625	hsa-miR-4776-3p	CLIP-seq
MIRT997626	hsa-miR-4789-3p	CLIP-seq
MIRT2533691	hsa-miR-4799-3p	CLIP-seq
MIRT997629	hsa-miR-497	CLIP-seq
MIRT997630	hsa-miR-499-5p	CLIP-seq
MIRT2533692	hsa-miR-603	CLIP-seq
MIRT2533693	hsa-miR-620	CLIP-seq
MIRT2533694	hsa-miR-627	CLIP-seq
MIRT2533695	hsa-miR-655	CLIP-seq
MIRT997639	hsa-miR-761	CLIP-seq
MIRT997640	hsa-miR-769-5p	CLIP-seq
MIRT997641	hsa-miR-874	CLIP-seq
MIRT1995743	hsa-miR-892a	CLIP-seq
MIRT2533696	hsa-miR-892b	CLIP-seq
MIRT2533697	hsa-miR-924	CLIP-seq
MIRT997642	hsa-miR-939	CLIP-seq

Show/Hide all (26)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003755	Function	Peptidyl-prolyl cis-trans isomerase activity	IBA
GO:0003755	Function	Peptidyl-prolyl cis-trans isomerase activity	IDA	11350175
GO:0003755	Function	Peptidyl-prolyl cis-trans isomerase activity	IEA
GO:0005515	Function	Protein binding	IPI	14676191, 14743216, 19615732, 19875381, 20562859, 21170051, 21360678, 23455922, 23602568, 24169621, 24981860, 25036637, 25852190, 27086506, 28514442, 29079741, 30021884, 30382094, 32296183, 32707033, 33961781, 34591612, 35271311
GO:0005528	Function	FK506 binding	IEA
GO:0005528	Function	FK506 binding	TAS	9001212
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IC	28147277
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0006457	Process	Protein folding	IBA
GO:0006457	Process	Protein folding	IDA	11350175
GO:0006457	Process	Protein folding	TAS	9001212
GO:0009617	Process	Response to bacterium	IEA
GO:0016020	Component	Membrane	HDA	19946888
GO:0016853	Function	Isomerase activity	IEA
GO:0030674	Function	Protein-macromolecule adaptor activity	IDA	28147277
GO:0031072	Function	Heat shock protein binding	IEA
GO:0031072	Function	Heat shock protein binding	IPI	9660753
GO:0042220	Process	Response to cocaine	IEA
GO:0043491	Process	Phosphatidylinositol 3-kinase/protein kinase B signal transduction	IDA	28147277
GO:0051898	Process	Negative regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IMP	17386267
GO:0070062	Component	Extracellular exosome	HDA	19056867
GO:0097305	Process	Response to alcohol	IEA

MIM	HGNC	e!Ensembl
602623	3721	ENSG00000096060

Q13451

Protein name

Peptidyl-prolyl cis-trans isomerase FKBP5 (PPIase FKBP5) (EC 5.2.1.8) (51 kDa FK506-binding protein) (51 kDa FKBP) (FKBP-51) (54 kDa progesterone receptor-associated immunophilin) (Androgen-regulated protein 6) (FF1 antigen) (FK506-binding protein 5) (FKB

Protein function

Immunophilin protein with PPIase and co-chaperone activities (PubMed:11350175). Component of unligated steroid receptors heterocomplexes through interaction with heat-shock protein 90 (HSP90). Plays a role in the intracellular trafficking of het

PDB

1KT0 , 3O5D , 3O5E , 3O5F , 3O5G , 3O5I , 3O5J , 3O5K , 3O5L , 3O5M , 3O5O , 3O5P , 3O5Q , 3O5R , 4DRH , 4DRI , 4DRK , 4DRM , 4DRN , 4DRO , 4DRP , 4DRQ , 4JFI , 4JFJ , 4JFK , 4JFL , 4JFM , 4R0X , 4TW6 , 4TW7 , 4TX0 , 4W9O , 4W9P , 4W9Q , 5BXJ , 5DIT , 5DIU , 5DIV , 5NJX , 5OBK , 5OMP , 6SAF , 6TX4 , 6TX5 , 6TX6 , 6TX7 , 6TX8 , 6TX9 , 6TXX , 7A6W , 7A6X

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00254	FKBP_C	43 → 135	FKBP-type peptidyl-prolyl cis-trans isomerase	Domain
PF00254	FKBP_C	158 → 248	FKBP-type peptidyl-prolyl cis-trans isomerase	Domain
PF00515	TPR_1	318 → 350	Tetratricopeptide repeat	Repeat

Tissue specificity

TISSUE SPECIFICITY: Widely expressed, enriched in testis compared to other tissues.

Sequence

MTTDEGAKNNEESPTATVAEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGK
LSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLP
KIPSNATLFFEIELLDFKGEDLFEDGGIIRRTKRKGEGYSNPNEGATVEIHLEGRCGGRM
FDCRDVAFTVGEGEDHDIPIGIDKALEKMQREEQCILYLGPRYGFGEAGKPKFGIEPNAE
LIYEVTLKSFEKAKESWEMDTKEKLEQAAIVKEKGTVYFKGGKYMQAVIQYGKIVSWLEM
EYGLSEKESKASESFLLAAFLNLAMCYLKLREYTKAVECCDKALGLDSANEKGLYRRGEA
QLLMNEFESAKGDFEKVLEVNPQNKAARLQISMCQKKAKEHNERDRRIYANMFKKFAEQD
AKEEANKAMGKKTSEGVTNEKGTDSQAMEEEKPEGHV

Sequence length

457

Interactions

View interactions

	KEGG		Reactome
	Estrogen signaling pathway		HSP90 chaperone cycle for steroid hormone receptors (SHR) ESR-mediated signaling

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (27)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Antidepressant drug treatment, accelerated response to	drug response; risk factor	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ARTHRITIS, RHEUMATOID	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	risk factor	ClinVar Disgenet	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
BIPOLAR DISORDER	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CLINICAL DEPRESSION	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL ADENOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSIVE DISORDER	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSIVE DISORDER, MAJOR	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIOSIS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOTHYROIDISM	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IDIOPATHIC PULMONARY FIBROSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSION, SINGLE EPISODE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	ClinVar, Disgenet ClinVar, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MENTAL DEPRESSION	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOOD DISORDERS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NONORGANIC PSYCHOSIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS, HIP	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Post-traumatic stress disorder	Likely risk allele	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSYCHOTIC DISORDERS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RECURRENT MAJOR DEPRESSIVE EPISODES	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Susceptibility to severe depressive disorder	Likely risk allele	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 1 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UNIPOLAR DEPRESSION	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (175)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma	Adenocarcinoma	BEFREE	18443959, 29113312		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of colon	Adenocarcinoma Of Colon	BEFREE	18443959		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma Of Esophagus	Esophageal Cancer	BEFREE	26467701, 29052817		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of large intestine	Colorectal Cancer	BEFREE	18443959		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of large intestine	Colorectal Cancer	GWASCAT_DG	30510241, 31089142		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of pancreas	Pancreatic adenocarcinoma	BEFREE	23936393		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma of large intestine	Colorectal adenoma	GWASCAT_DG	30510241		★★★★★ ★☆☆☆☆ Found in Text Mining only
Affective Disorders, Psychotic	Affective Psychosis	BEFREE	17081296		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	35205209	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	28011744		★★★★★ ★☆☆☆☆ Found in Text Mining only
AMYOTROPHIC LATERAL SCLEROSIS 1	Lateral Sclerosis	BEFREE	10077670		★★★★★ ★☆☆☆☆ Found in Text Mining only
Antisocial Personality Disorder	Antisocial Personality Disorder	BEFREE	29867390		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	18291582, 22459275, 23219223, 26521051, 27448712, 28863347, 28889074, 29466454, 30107269, 30240345, 30310158, 30334356, 30585227, 31167373		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety disorder	Pubtator	23274505, 26424511, 28300138, 28364727, 29466454, 30036794, 30334356, 31908177, 31931271, 33705478, 34715840, 35205209, 38460581	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	18291582, 19560279, 22459275, 23219223, 23406438, 23861224, 24219237, 24411633, 24756342, 26521051, 27448712, 28863347, 28889074, 29466454, 30107269 View all (5 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety disorder	Pubtator	23406438, 24253961, 24411633, 24756342	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Valve Insufficiency	Aortic Valve Insufficiency	BEFREE	20048054		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	17082220, 36941600	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	20156738, 20853021, 23762334, 28045928, 30059697		★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Asthma	Asthma	Pubtator	39868576	Associate	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Atrial Fibrillation	Atrial fibrillation	Pubtator	25706326	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Attention Deficit and Disruptive Behavior Disorders	Attention deficit hyperactivity disorder	Pubtator	26228411	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	BEFREE	26032970		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	25912394		★★★★★ ★☆☆☆☆ Found in Text Mining only
Binge Drinking	Binge drinking	Pubtator	31931271	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	18180755, 24345775, 24856550, 25517604, 28002634, 28030643, 28822116, 31071710		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	PSYGENET_DG	18180755, 21935478, 24345775, 24856550, 25522387		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar disorder	Pubtator	18180755, 24345775, 25522387, 28002634, 28030643, 30524168	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Borderline Personality Disorder	Borderline personality disorder	Pubtator	25047302	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Borderline Personality Disorder	Borderline personality disorder	BEFREE	26182893, 30711865, 31071710		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	31908177, 37987640	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchopulmonary Dysplasia	Bronchopulmonary Dysplasia	BEFREE	30711865, 31071710		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bruck syndrome 1	Bruck syndrome	Pubtator	27298363	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	35865544	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	Pubtator	32631246	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	34713710	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	29951131	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	30575921		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	20156738, 31022961		★★★★★ ★☆☆☆☆ Found in Text Mining only
clinical depression	Mental Depression	BEFREE	20047716		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
clinical depression	Mental Depression	PSYGENET_DG	20047716		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cognition Disorders	Cognition disorder	Pubtator	30524168	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	28441737		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	GWASCAT_DG	30510241, 31089142		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	28441737	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	GWASCAT_DG	30510241, 31089142		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	GWASCAT_DG	29212778		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Disease	Coronary artery disease	Pubtator	32860562	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cortical cataract	Cortical cataract	BEFREE	27664120		★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	21788965		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cushing Syndrome	Cushing`s Syndrome	BEFREE	27664120		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cushing Syndrome	Cushing syndrome	Pubtator	27664120, 34914631, 36329530	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	30317616		★★★★★ ★☆☆☆☆ Found in Text Mining only
Delirium	Delirium	Pubtator	35017578	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Delirium	Delirium	Pubtator	35017578	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive Disorder	Major depressive disorder	Pubtator	17081296, 18180755, 23406438, 24411633, 24756342, 26424511, 26740367, 28590587, 29466454, 29936334, 30036794, 31908177, 31931271, 32699209, 32860562, 37628589 View all (1 more)	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive disorder	Mental Depression	BEFREE	17467808, 18191112, 18702710, 19676097, 20047716, 20226536, 21654733, 21865530, 22134958, 22459275, 22548329, 22581765, 22990943, 23157339, 23219223 View all (37 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive disorder	Mental Depression	PSYGENET_DG	23861224, 24655651, 24889341, 25386878, 25522420		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive Disorder Major	Major depressive disorder	Pubtator	18180755, 20726698, 23406438, 26371764, 28002634, 29182159, 31113877, 36825897	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	24997500, 30669684		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	24997500, 30669684		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	29951131	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	30032404	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	24997500, 27941579, 30032404, 31668388		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	34858345, 37745718, 40114624	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	Pubtator	32860562	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial adenocarcinoma	Endometrial Adenocarcinoma	BEFREE	29113312		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrioma	Endometrioma	CTD_human_DG	20864642		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	CTD_human_DG	20864642		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Eosinophilia	Eosinophilia	BEFREE	23762334		★★★★★ ★☆☆☆☆ Found in Text Mining only
Eosinophilic esophagitis	Eosinophilia	BEFREE	20371398		★★★★★ ★☆☆☆☆ Found in Text Mining only
Eosinophilic Esophagitis	Eosinophilia	Pubtator	20371398	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	Pubtator	36825897, 37078238, 37628589	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial multiple trichoepitheliomata	Multiple Trichoepithelioma	BEFREE	29052817		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	28978117, 30794467		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	28978117, 30794467		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	18320068, 28978117		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	LHGDN	18320068		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	18320068	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulonephritis IGA	Iga nephropathy	Pubtator	39516745	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glucocorticoid Receptor Deficiency	Glucocorticoid Receptor Deficiency	BEFREE	20156738, 21788965, 26630184, 30702561		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glucocorticoid Receptor Deficiency	Glucocorticoid receptor deficiency/resistance	Pubtator	32699209	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hamartoma Syndrome, Multiple	Hamartoma	BEFREE	27664120		★★★★★ ★☆☆☆☆ Found in Text Mining only
Headache	Headache	Pubtator	37078238	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	34713710	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperandrogenism	Hyperandrogenism	Pubtator	35787810	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	BEFREE	29170369		★★★★★ ★☆☆☆☆ Found in Text Mining only
Immune thrombocytopenic purpura	Immune Thrombocytopenic Purpura	BEFREE	22825419		★★★★★ ★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	30032404, 32958048	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Involutional Depression	Involutional Depression	CTD_human_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Involutional paraphrenia	Involutional Paraphrenia	CTD_human_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Iron Overload	Iron overload	Pubtator	34713710	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure Chronic	Kidney failure	Pubtator	34858345	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Learning Disabilities	Learning disorders	Pubtator	28002634	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leiomyoma	Leiomyoma	Pubtator	35426036	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	27688096		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, T-Cell, Cutaneous	Lymphoma	BEFREE	28977697		★★★★★ ★☆☆☆☆ Found in Text Mining only
Major depression, single episode	Mental Depression	BEFREE	21865530		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Major Depressive Disorder	Mental Depression	BEFREE	19199039, 19545546, 20726698, 21935478, 22237309, 23157339, 23324805, 23406438, 23861224, 24856550, 25355489, 25436518, 25522420, 26645208, 27030168 View all (14 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Major Depressive Disorder	Mental Depression	PSYGENET_DG	23861224, 24856550, 25355489, 25436518, 25522420		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Major Depressive Disorder	Mental Depression	CTD_human_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant neoplasm of large intestine	Colorectal Neoplasms	GWASCAT_DG	30510241, 31089142		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	22590527, 23936393, 28363942, 30770779		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	15131019, 15821585, 20023700, 27718274, 28032931		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	22459275		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	19696786, 19732725, 21514887, 21530399, 21565553, 22459275, 27718274, 28590587, 28977697, 29052817		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	GWASCAT_DG	30510241, 31089142		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	19696786, 23559012, 25895097, 25942396, 28032931, 30451787		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	28434031	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	17467808, 18191112, 18702710, 19676097, 20047716, 20226536, 21654733, 21865530, 22134958, 22459275, 22548329, 22581765, 22990943, 23157339, 23219223 View all (35 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental Depression	Mental Depression	PSYGENET_DG	23861224, 24655651, 24889341, 25386878, 25522420		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental disorders	Mental Disorders	BEFREE	19199039, 19560279, 22825419, 23201972, 23327756, 23407841, 24040820, 25115650, 25331639, 25436518, 26740367, 27485401, 27527158, 27691985, 27829158 View all (9 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	30669684, 31668388		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	31668388		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood Disorder	BEFREE	20709156, 21907973, 22581765, 24040820, 24253961, 24845178, 25386878, 28850857, 29203717, 30544098, 30619472		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mood Disorders	Mood disorder	Pubtator	23407841, 27389186, 33829973	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mood Disorders	Mood Disorder	PSYGENET_DG	23945090, 24040820, 24253961, 24845178, 25386878		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Infarction	Myocardial infarction	Pubtator	31113877	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	36769373	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	19696786, 20048054, 21530399, 21565553, 22590527, 23936393, 25895097, 25942396, 28218707, 28434031, 28978117, 30451787, 30546435		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome	Nephrotic Syndrome	BEFREE	28992850		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	35205209	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
NEUROTICISM	Neuroticism	BEFREE	27552816		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nonorganic psychosis	Nonorganic Psychosis	BEFREE	23327756, 27389186, 28889074		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonorganic psychosis	Nonorganic Psychosis	PSYGENET_DG	23429203		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	BEFREE	28007534, 29520627, 30507783, 30669684, 31668388		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	32958048	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	34267209, 35817784, 39868576	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Obsessive-Compulsive Disorder	Obsessive-Compulsive Disorder	BEFREE	30107269		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ocular Hypertension	Ocular Hypertension	BEFREE	24417561		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteitis Deformans	Paget disease	BEFREE	28524179		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	34914631	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	22590527, 23936393, 28363942		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	23936393	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	30546435		★★★★★ ★☆☆☆☆ Found in Text Mining only
Paranoia	Paranoia	BEFREE	27389186		★★★★★ ★☆☆☆☆ Found in Text Mining only
Paranoid Disorders	Paranoia	Pubtator	27389186	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	31830361		★★★★★ ★☆☆☆☆ Found in Text Mining only
Paroxysmal atrial fibrillation	Paroxysmal atrial fibrillation	BEFREE	25706326		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pervasive Development Disorder	Autism spectrum disorder	BEFREE	25912394		★★★★★ ★☆☆☆☆ Found in Text Mining only
Phobic anxiety disorder	Phobic Anxiety Disorder	BEFREE	28025095		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pituitary Diseases	Pituitary Diseases	BEFREE	30986730		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	34267209, 35787810	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Post-Traumatic Stress Disorder	Stress Disorder	BEFREE	18349090, 18702710, 19393990, 20393453, 21508514, 21536970, 21907973, 21935478, 22134958, 22137507, 22548329, 22981834, 23429203, 23856297, 23861224 View all (28 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Primary Myelofibrosis	Myelofibrosis	BEFREE	12351405, 15089760		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary Myelofibrosis	Myelofibrosis	LHGDN	12351405		★★★★★ ★☆☆☆☆ Found in Text Mining only
Progesterone Resistance	Progesterone Resistance	BEFREE	12746298		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	15131019, 15821585, 20023700, 27718274, 28032931		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Hyperplasia	Prostatic hyperplasia	Pubtator	19676094	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	15131019		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	25829060	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Psychosis, Involutional	Psychosis	CTD_human_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychosis	BEFREE	23327756, 25115650, 27389186, 28889074		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psychotic Disorders	Psychosis	PSYGENET_DG	23429203		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psychotic Disorders	Psychotic disorders	Pubtator	24345775, 27389186	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	31022961	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinitis Pigmentosa Concentric	Retinitis pigmentosa	Pubtator	25331639	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	CTD_human_DG	12833524		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	20346245, 29441870		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	Pubtator	24345775, 36729133	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	25592294, 25751398, 26424418, 27552816, 31296417		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	Pubtator	30524168	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Seizures	Seizures	Pubtator	36825897	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sleep Disorders	Sleep Disorders	BEFREE	24354785		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	28218707		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	22459275		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Diseases	Stomach Diseases	BEFREE	29148176		★★★★★ ★☆☆☆☆ Found in Text Mining only
Tauopathies	Tauopathies	BEFREE	23999428		★★★★★ ★☆☆☆☆ Found in Text Mining only
Trigeminal Neuralgia	Trigeminal neuralgia	Pubtator	38158702	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	21788965		★★★★★ ★☆☆☆☆ Found in Text Mining only
Unipolar Depression	Mental Depression	BEFREE	19199039, 19545546, 20726698, 21935478, 22237309, 23324805, 23406438, 24856550, 25436518, 25522420, 26645208, 28002634, 28198448, 28850857, 28989100 View all (5 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Unipolar Depression	Mental Depression	PSYGENET_DG	23861224, 24856550, 25355489, 25436518, 25522420		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine Fibroids	Uterine Fibroids	BEFREE	31665442		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ventricular Remodeling	Ventricular remodeling	Pubtator	34713710	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Young onset Parkinson disease	Parkinson disease	BEFREE	30734931		★★★★★ ★☆☆☆☆ Found in Text Mining only

FKBP5 (FKBP prolyl isomerase 5)