Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Associated diseases
Entrez ID	22882
Gene name	Zinc fingers and homeoboxes 2
Gene symbol	ZHX2
Synonyms (NCBI Gene)	AFR1RAF
Chromosome	8
Chromosome location	8q24.13
Summary	The members of the zinc fingers and homeoboxes gene family are nuclear homodimeric transcriptional repressors that interact with the A subunit of nuclear factor-Y (NF-YA) and contain two C2H2-type zinc fingers and five homeobox DNA-binding domains. This g

281

Show/Hide all (281)

miRTarBase ID	miRNA	Experiments	Reference
MIRT438491	hsa-miR-139-5p	Luciferase reporter assay	24158791
MIRT438491	hsa-miR-139-5p	Luciferase reporter assay	24158791
MIRT734079	hsa-miR-181a-2-3p	Luciferase reporter assay	31880394
MIRT1513020	hsa-miR-106a	CLIP-seq
MIRT1513021	hsa-miR-106b	CLIP-seq
MIRT1513022	hsa-miR-1237	CLIP-seq
MIRT1513023	hsa-miR-1248	CLIP-seq
MIRT1513024	hsa-miR-1253	CLIP-seq
MIRT1513025	hsa-miR-1271	CLIP-seq
MIRT1513026	hsa-miR-138	CLIP-seq
MIRT1513027	hsa-miR-17	CLIP-seq
MIRT1513028	hsa-miR-182	CLIP-seq
MIRT1513029	hsa-miR-190	CLIP-seq
MIRT1513030	hsa-miR-190b	CLIP-seq
MIRT1513031	hsa-miR-199a-3p	CLIP-seq
MIRT1513032	hsa-miR-199b-3p	CLIP-seq
MIRT1513033	hsa-miR-20a	CLIP-seq
MIRT1513034	hsa-miR-20b	CLIP-seq
MIRT1513035	hsa-miR-217	CLIP-seq
MIRT1513036	hsa-miR-2467-3p	CLIP-seq
MIRT1513037	hsa-miR-3117-3p	CLIP-seq
MIRT1513038	hsa-miR-3129-5p	CLIP-seq
MIRT1513039	hsa-miR-3169	CLIP-seq
MIRT1513040	hsa-miR-3182	CLIP-seq
MIRT1513041	hsa-miR-4282	CLIP-seq
MIRT1513042	hsa-miR-4418	CLIP-seq
MIRT1513043	hsa-miR-4436b-3p	CLIP-seq
MIRT1513044	hsa-miR-4637	CLIP-seq
MIRT1513045	hsa-miR-4721	CLIP-seq
MIRT1513046	hsa-miR-4759	CLIP-seq
MIRT1513047	hsa-miR-4761-3p	CLIP-seq
MIRT1513048	hsa-miR-4772-3p	CLIP-seq
MIRT1513049	hsa-miR-4774-5p	CLIP-seq
MIRT1513050	hsa-miR-4786-3p	CLIP-seq
MIRT1513051	hsa-miR-485-3p	CLIP-seq
MIRT1513052	hsa-miR-509-3-5p	CLIP-seq
MIRT1513053	hsa-miR-509-5p	CLIP-seq
MIRT1513054	hsa-miR-510	CLIP-seq
MIRT1513055	hsa-miR-519a	CLIP-seq
MIRT1513056	hsa-miR-519b-3p	CLIP-seq
MIRT1513057	hsa-miR-519c-3p	CLIP-seq
MIRT1513058	hsa-miR-519d	CLIP-seq
MIRT1513059	hsa-miR-548t	CLIP-seq
MIRT1513060	hsa-miR-570	CLIP-seq
MIRT1513061	hsa-miR-580	CLIP-seq
MIRT1513062	hsa-miR-593	CLIP-seq
MIRT1513063	hsa-miR-624	CLIP-seq
MIRT1513064	hsa-miR-654-3p	CLIP-seq
MIRT1513065	hsa-miR-660	CLIP-seq
MIRT1513066	hsa-miR-711	CLIP-seq
MIRT1513067	hsa-miR-93	CLIP-seq
MIRT1513068	hsa-miR-96	CLIP-seq
MIRT2154501	hsa-miR-105	CLIP-seq
MIRT2154502	hsa-miR-1236	CLIP-seq
MIRT2154503	hsa-miR-1244	CLIP-seq
MIRT2154504	hsa-miR-1289	CLIP-seq
MIRT1513026	hsa-miR-138	CLIP-seq
MIRT2154505	hsa-miR-145	CLIP-seq
MIRT2154506	hsa-miR-185	CLIP-seq
MIRT1513036	hsa-miR-2467-3p	CLIP-seq
MIRT2154507	hsa-miR-31	CLIP-seq
MIRT2154508	hsa-miR-3128	CLIP-seq
MIRT2154509	hsa-miR-3136-3p	CLIP-seq
MIRT2154510	hsa-miR-3150a-3p	CLIP-seq
MIRT2154511	hsa-miR-3175	CLIP-seq
MIRT1513040	hsa-miR-3182	CLIP-seq
MIRT2154512	hsa-miR-3198	CLIP-seq
MIRT2154513	hsa-miR-3614-5p	CLIP-seq
MIRT2154514	hsa-miR-3616-3p	CLIP-seq
MIRT2154515	hsa-miR-3652	CLIP-seq
MIRT2154516	hsa-miR-378	CLIP-seq
MIRT2154517	hsa-miR-378b	CLIP-seq
MIRT2154518	hsa-miR-378c	CLIP-seq
MIRT2154519	hsa-miR-378d	CLIP-seq
MIRT2154520	hsa-miR-378e	CLIP-seq
MIRT2154521	hsa-miR-378f	CLIP-seq
MIRT2154522	hsa-miR-378h	CLIP-seq
MIRT2154523	hsa-miR-378i	CLIP-seq
MIRT2154524	hsa-miR-422a	CLIP-seq
MIRT2154525	hsa-miR-4251	CLIP-seq
MIRT2154526	hsa-miR-4269	CLIP-seq
MIRT2154527	hsa-miR-4294	CLIP-seq
MIRT2154528	hsa-miR-4306	CLIP-seq
MIRT2154529	hsa-miR-4309	CLIP-seq
MIRT2154530	hsa-miR-432	CLIP-seq
MIRT2154531	hsa-miR-4329	CLIP-seq
MIRT2154532	hsa-miR-4430	CLIP-seq
MIRT1513043	hsa-miR-4436b-3p	CLIP-seq
MIRT2154533	hsa-miR-4436b-5p	CLIP-seq
MIRT2154534	hsa-miR-4461	CLIP-seq
MIRT2154535	hsa-miR-4474-5p	CLIP-seq
MIRT2154536	hsa-miR-4505	CLIP-seq
MIRT2154537	hsa-miR-451b	CLIP-seq
MIRT2154538	hsa-miR-4641	CLIP-seq
MIRT2154539	hsa-miR-4644	CLIP-seq
MIRT2154540	hsa-miR-4645-5p	CLIP-seq
MIRT2154541	hsa-miR-4667-5p	CLIP-seq
MIRT2154542	hsa-miR-4673	CLIP-seq
MIRT2154543	hsa-miR-4693-3p	CLIP-seq
MIRT2154544	hsa-miR-4700-5p	CLIP-seq
MIRT2154545	hsa-miR-4710	CLIP-seq
MIRT2154546	hsa-miR-4712-5p	CLIP-seq
MIRT1513045	hsa-miR-4721	CLIP-seq
MIRT2154547	hsa-miR-4731-5p	CLIP-seq
MIRT1513047	hsa-miR-4761-3p	CLIP-seq
MIRT1513049	hsa-miR-4774-5p	CLIP-seq
MIRT2154548	hsa-miR-4778-3p	CLIP-seq
MIRT2154549	hsa-miR-4786-5p	CLIP-seq
MIRT2154550	hsa-miR-548c-3p	CLIP-seq
MIRT1513059	hsa-miR-548t	CLIP-seq
MIRT2154551	hsa-miR-562	CLIP-seq
MIRT2154552	hsa-miR-610	CLIP-seq
MIRT2154553	hsa-miR-617	CLIP-seq
MIRT2154554	hsa-miR-663b	CLIP-seq
MIRT2154555	hsa-miR-770-5p	CLIP-seq
MIRT2154556	hsa-miR-890	CLIP-seq
MIRT2154557	hsa-miR-939	CLIP-seq
MIRT2154501	hsa-miR-105	CLIP-seq
MIRT2374693	hsa-miR-1224-3p	CLIP-seq
MIRT1513022	hsa-miR-1237	CLIP-seq
MIRT1513023	hsa-miR-1248	CLIP-seq
MIRT2374694	hsa-miR-1260	CLIP-seq
MIRT2374695	hsa-miR-1260b	CLIP-seq
MIRT2374696	hsa-miR-1278	CLIP-seq
MIRT2374697	hsa-miR-1280	CLIP-seq
MIRT2374698	hsa-miR-1285	CLIP-seq
MIRT2374699	hsa-miR-140-3p	CLIP-seq
MIRT2374700	hsa-miR-147b	CLIP-seq
MIRT2374701	hsa-miR-150	CLIP-seq
MIRT2374702	hsa-miR-155	CLIP-seq
MIRT2374703	hsa-miR-183	CLIP-seq
MIRT2154506	hsa-miR-185	CLIP-seq
MIRT2374704	hsa-miR-188-3p	CLIP-seq
MIRT1513029	hsa-miR-190	CLIP-seq
MIRT1513030	hsa-miR-190b	CLIP-seq
MIRT2374705	hsa-miR-1915	CLIP-seq
MIRT2374706	hsa-miR-210	CLIP-seq
MIRT1513035	hsa-miR-217	CLIP-seq
MIRT1513036	hsa-miR-2467-3p	CLIP-seq
MIRT2374707	hsa-miR-2681	CLIP-seq
MIRT2374708	hsa-miR-2682	CLIP-seq
MIRT2374709	hsa-miR-3064-5p	CLIP-seq
MIRT2154507	hsa-miR-31	CLIP-seq
MIRT2154509	hsa-miR-3136-3p	CLIP-seq
MIRT2154510	hsa-miR-3150a-3p	CLIP-seq
MIRT2374710	hsa-miR-3156-3p	CLIP-seq
MIRT2374711	hsa-miR-3157-5p	CLIP-seq
MIRT1513039	hsa-miR-3169	CLIP-seq
MIRT2154511	hsa-miR-3175	CLIP-seq
MIRT2374712	hsa-miR-3185	CLIP-seq
MIRT2374713	hsa-miR-3187-5p	CLIP-seq
MIRT2374714	hsa-miR-3192	CLIP-seq
MIRT2374715	hsa-miR-326	CLIP-seq
MIRT2374716	hsa-miR-330-5p	CLIP-seq
MIRT2374717	hsa-miR-34a	CLIP-seq
MIRT2374718	hsa-miR-34c-5p	CLIP-seq
MIRT2374719	hsa-miR-3591-3p	CLIP-seq
MIRT2154514	hsa-miR-3616-3p	CLIP-seq
MIRT2374720	hsa-miR-3646	CLIP-seq
MIRT2154515	hsa-miR-3652	CLIP-seq
MIRT2374721	hsa-miR-3671	CLIP-seq
MIRT2374722	hsa-miR-3689a-3p	CLIP-seq
MIRT2374723	hsa-miR-3689c	CLIP-seq
MIRT2374724	hsa-miR-3689d	CLIP-seq
MIRT2374725	hsa-miR-3714	CLIP-seq
MIRT2154516	hsa-miR-378	CLIP-seq
MIRT2154517	hsa-miR-378b	CLIP-seq
MIRT2154518	hsa-miR-378c	CLIP-seq
MIRT2154519	hsa-miR-378d	CLIP-seq
MIRT2154520	hsa-miR-378e	CLIP-seq
MIRT2154521	hsa-miR-378f	CLIP-seq
MIRT2154522	hsa-miR-378h	CLIP-seq
MIRT2154523	hsa-miR-378i	CLIP-seq
MIRT2374726	hsa-miR-384	CLIP-seq
MIRT2374727	hsa-miR-3909	CLIP-seq
MIRT2374728	hsa-miR-3935	CLIP-seq
MIRT2154524	hsa-miR-422a	CLIP-seq
MIRT2154525	hsa-miR-4251	CLIP-seq
MIRT2154526	hsa-miR-4269	CLIP-seq
MIRT2374729	hsa-miR-4272	CLIP-seq
MIRT2374730	hsa-miR-4302	CLIP-seq
MIRT2154528	hsa-miR-4306	CLIP-seq
MIRT2374731	hsa-miR-4314	CLIP-seq
MIRT2154531	hsa-miR-4329	CLIP-seq
MIRT1513042	hsa-miR-4418	CLIP-seq
MIRT2374732	hsa-miR-4424	CLIP-seq
MIRT2154532	hsa-miR-4430	CLIP-seq
MIRT1513043	hsa-miR-4436b-3p	CLIP-seq
MIRT2374733	hsa-miR-4446-3p	CLIP-seq
MIRT2154534	hsa-miR-4461	CLIP-seq
MIRT2154535	hsa-miR-4474-5p	CLIP-seq
MIRT2374734	hsa-miR-4492	CLIP-seq
MIRT2374735	hsa-miR-4498	CLIP-seq
MIRT2374736	hsa-miR-449a	CLIP-seq
MIRT2374737	hsa-miR-449b	CLIP-seq
MIRT2374738	hsa-miR-449c	CLIP-seq
MIRT2154536	hsa-miR-4505	CLIP-seq
MIRT2374739	hsa-miR-4523	CLIP-seq
MIRT2154538	hsa-miR-4641	CLIP-seq
MIRT2154539	hsa-miR-4644	CLIP-seq
MIRT2154540	hsa-miR-4645-5p	CLIP-seq
MIRT2374740	hsa-miR-4646-5p	CLIP-seq
MIRT2374741	hsa-miR-4648	CLIP-seq
MIRT2374742	hsa-miR-4654	CLIP-seq
MIRT2154541	hsa-miR-4667-5p	CLIP-seq
MIRT2374743	hsa-miR-4668-3p	CLIP-seq
MIRT2154542	hsa-miR-4673	CLIP-seq
MIRT2374744	hsa-miR-4685-5p	CLIP-seq
MIRT2154543	hsa-miR-4693-3p	CLIP-seq
MIRT2154544	hsa-miR-4700-5p	CLIP-seq
MIRT2154545	hsa-miR-4710	CLIP-seq
MIRT2154546	hsa-miR-4712-5p	CLIP-seq
MIRT2374745	hsa-miR-4713-5p	CLIP-seq
MIRT1513045	hsa-miR-4721	CLIP-seq
MIRT2374746	hsa-miR-4726-3p	CLIP-seq
MIRT2374747	hsa-miR-4728-5p	CLIP-seq
MIRT2154547	hsa-miR-4731-5p	CLIP-seq
MIRT2374748	hsa-miR-4746-3p	CLIP-seq
MIRT1513047	hsa-miR-4761-3p	CLIP-seq
MIRT2374749	hsa-miR-4769-5p	CLIP-seq
MIRT1513048	hsa-miR-4772-3p	CLIP-seq
MIRT1513049	hsa-miR-4774-5p	CLIP-seq
MIRT2154549	hsa-miR-4786-5p	CLIP-seq
MIRT1513051	hsa-miR-485-3p	CLIP-seq
MIRT2374750	hsa-miR-486-3p	CLIP-seq
MIRT1513052	hsa-miR-509-3-5p	CLIP-seq
MIRT1513053	hsa-miR-509-5p	CLIP-seq
MIRT2374751	hsa-miR-532-3p	CLIP-seq
MIRT2374752	hsa-miR-539	CLIP-seq
MIRT2374753	hsa-miR-548aa	CLIP-seq
MIRT2374754	hsa-miR-548an	CLIP-seq
MIRT2374755	hsa-miR-548n	CLIP-seq
MIRT1513059	hsa-miR-548t	CLIP-seq
MIRT1513060	hsa-miR-570	CLIP-seq
MIRT1513062	hsa-miR-593	CLIP-seq
MIRT2154552	hsa-miR-610	CLIP-seq
MIRT2374756	hsa-miR-612	CLIP-seq
MIRT2154553	hsa-miR-617	CLIP-seq
MIRT1513064	hsa-miR-654-3p	CLIP-seq
MIRT2154554	hsa-miR-663b	CLIP-seq
MIRT2374757	hsa-miR-762	CLIP-seq
MIRT2154555	hsa-miR-770-5p	CLIP-seq
MIRT2374758	hsa-miR-888	CLIP-seq
MIRT2374759	hsa-miR-936	CLIP-seq
MIRT2154557	hsa-miR-939	CLIP-seq
MIRT1513059	hsa-miR-548t	CLIP-seq
MIRT2374696	hsa-miR-1278	CLIP-seq
MIRT1513026	hsa-miR-138	CLIP-seq
MIRT2667280	hsa-miR-186	CLIP-seq
MIRT2667281	hsa-miR-18a	CLIP-seq
MIRT2667282	hsa-miR-18b	CLIP-seq
MIRT2374708	hsa-miR-2682	CLIP-seq
MIRT2667283	hsa-miR-3133	CLIP-seq
MIRT1513040	hsa-miR-3182	CLIP-seq
MIRT2374712	hsa-miR-3185	CLIP-seq
MIRT2374717	hsa-miR-34a	CLIP-seq
MIRT2374718	hsa-miR-34c-5p	CLIP-seq
MIRT2374725	hsa-miR-3714	CLIP-seq
MIRT2374736	hsa-miR-449a	CLIP-seq
MIRT2374737	hsa-miR-449b	CLIP-seq
MIRT2374738	hsa-miR-449c	CLIP-seq
MIRT2667284	hsa-miR-4720-3p	CLIP-seq
MIRT2667285	hsa-miR-4735-3p	CLIP-seq
MIRT1513049	hsa-miR-4774-5p	CLIP-seq
MIRT2667286	hsa-miR-4804-3p	CLIP-seq
MIRT2374752	hsa-miR-539	CLIP-seq
MIRT2374754	hsa-miR-548an	CLIP-seq
MIRT2374696	hsa-miR-1278	CLIP-seq
MIRT1513026	hsa-miR-138	CLIP-seq
MIRT2374708	hsa-miR-2682	CLIP-seq
MIRT1513040	hsa-miR-3182	CLIP-seq
MIRT2374712	hsa-miR-3185	CLIP-seq
MIRT2374717	hsa-miR-34a	CLIP-seq
MIRT2374718	hsa-miR-34c-5p	CLIP-seq
MIRT2374725	hsa-miR-3714	CLIP-seq
MIRT2374736	hsa-miR-449a	CLIP-seq
MIRT2374737	hsa-miR-449b	CLIP-seq
MIRT2374738	hsa-miR-449c	CLIP-seq
MIRT1513049	hsa-miR-4774-5p	CLIP-seq
MIRT2374752	hsa-miR-539	CLIP-seq
MIRT2374754	hsa-miR-548an	CLIP-seq

Show/Hide all (2)

Transcription factor	Regulation	Reference
MSX1	Unknown	22078940
XBP1	Unknown	22078940

Show/Hide all (29)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	12741956
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000785	Component	Chromatin	ISA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0003677	Function	DNA binding	IEA
GO:0005515	Function	Protein binding	IPI	12741956, 26496610, 32814053
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	17056598
GO:0005634	Component	Nucleus	IDA	12741956
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005829	Component	Cytosol	IDA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IEA
GO:0006402	Process	MRNA catabolic process	IEA
GO:0007399	Process	Nervous system development	IEA
GO:0008270	Function	Zinc ion binding	IEA
GO:0021953	Process	Central nervous system neuron differentiation	IEA
GO:0030154	Process	Cell differentiation	IEA
GO:0035019	Process	Somatic stem cell population maintenance	IEA
GO:0042802	Function	Identical protein binding	IPI	12741956
GO:0042803	Function	Protein homodimerization activity	IDA	12741956
GO:0045665	Process	Negative regulation of neuron differentiation	IEA
GO:0045892	Process	Negative regulation of DNA-templated transcription	IDA	12741956
GO:0046872	Function	Metal ion binding	IEA
GO:0046982	Function	Protein heterodimerization activity	IDA	12741956
GO:0060040	Process	Retinal bipolar neuron differentiation	IEA

MIM	HGNC	e!Ensembl
609185	18513	ENSG00000178764

Q9Y6X8

Protein name

Zinc fingers and homeoboxes protein 2 (Alpha-fetoprotein regulator 1) (AFP regulator 1) (Regulator of AFP) (Zinc finger and homeodomain protein 2)

Protein function

Acts as a transcriptional repressor (PubMed:12741956). Represses the promoter activity of the CDC25C gene stimulated by NFYA (PubMed:12741956). May play a role in retinal development where it regulates the composition of bipolar cell populations

PDB

2DMP , 3NAU

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF18387	zf_C2H2_ZHX	106 → 158	Zinc-fingers and homeoboxes C2H2 finger domain	Domain
PF00046	Homeodomain	444 → 496	Homeodomain	Domain
PF00046	Homeodomain	534 → 584	Homeodomain	Domain
PF00046	Homeodomain	633 → 685	Homeodomain	Domain

Tissue specificity

TISSUE SPECIFICITY: Ubiquitously expressed. Expressed in podocytes. {ECO:0000269|PubMed:12741956, ECO:0000269|PubMed:17056598}.

Sequence

MASKRKSTTPCMVRTSQVVEQDVPEEVDRAKEKGIGTPQPDVAKDSWAAELENSSKENEV
IEVKSMGESQSKKLQGGYECKYCPYSTQNLNEFTEHVDMQHPNVILNPLYVCAECNFTTK
KYDSLSDHNSKFHPGEANFKLKLIKRNNQTVLEQSIETTNHVVSITTSGPGTGDSDSGIS
VSKTPIMKPGKPKADAKKVPKKPEEITPENHVEGTARLVTDTAEILSRLGGVELLQDTLG
HVMPSVQLPPNINLVPKVPVPLNTTKYNSALDTNATMINSFNKFPYPTQAELSWLTAASK
HPEEHIRIWFATQRLKHGISWSPEEVEEARKKMFNGTIQSVPPTITVLPAQLAPTKVTQP
ILQTALPCQILGQTSLVLTQVTSGSTTVSCSPITLAVAGVTNHGQKRPLVTPQAAPEPKR
PHIAQVPEPPPKVANPPLTPASDRKKTKEQIAHLKASFLQSQFPDDAEVYRLIEVTGLAR
SEIKKWFSDHRYRCQRGIVHITSESLAKDQLAIAASRHGRTYHAYPDFAPQKFKEKTQGQ
VKILEDSFLKSSFPTQAELDRLRVETKLSRREIDSWFSERRKLRDSMEQAVLDSMGSGKK
GQDVGAPNGALSRLDQLSGAQLTSSLPSPSPAIAKSQEQVHLLRSTFARTQWPTPQEYDQ
LAAKTGLVRTEIVRWFKENRCLLKTGTVKWMEQYQHQPMADDHGYDAVARKATKPMAESP
KNGGDVVPQYYKDPKKLCEEDLEKLVTRVKVGSEPAKDCLPAKPSEATSDRSEGSSRDGQ
GSDENEESSVVDYVEVTVGEEDAISDRSDSWSQAAAEGVSELAESDSDCVPAEAGQA

Sequence length

837

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (3)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Hirschsprung disease, susceptibility to, 1	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (205)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acromegaly	Acromegaly	BEFREE	25640882		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Cerebrovascular Accidents	Stroke	BEFREE	28236595		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute monocytic leukemia	Monocytic Leukemia	BEFREE	31430364		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	15513360, 16598499, 1996309, 26997442		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	27301828		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	21307665		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Hodgkin Lymphoma	Hodgkin Lymphoma	BEFREE	21987443, 22078940, 26406991		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anaplasia	Anaplasia	BEFREE	17179987		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anaplastic thyroid carcinoma	Anaplastic thyroid cancer	BEFREE	27797976		★★★★★ ★☆☆☆☆ Found in Text Mining only
Androgen Insensitivity Syndrome	Androgen insensitivity syndrome	Pubtator	35896920	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Aneuploidy	Aneuploidy	Pubtator	2538323	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	30065098		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Dissection	Aortic dissection	Pubtator	30816458	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	28059143, 30026271		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	23456299	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	21393386, 28082416		★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	21393386, 30575814, 36503484	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	28059143, 30026271		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	BEFREE	28236595		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorder	Autism	Pubtator	23879678	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	Pubtator	21848643, 27055244	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
beta Thalassemia	beta Thalassemia	BEFREE	21443521		★★★★★ ★☆☆☆☆ Found in Text Mining only
beta^+^ Thalassemia	beta Thalassemia	BEFREE	21443521		★★★★★ ★☆☆☆☆ Found in Text Mining only
Biliary Tract Neoplasms	Biliary tract neoplasms	Pubtator	15181454, 30563938, 31312030	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Blast Phase	Blast phase chronic myelogenous leukemia	BEFREE	3279421		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	19082503, 21393386, 22385786, 29880583		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	21393386, 29880583	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Tumor, Primary	Brain Neoplasms	BEFREE	26536389, 31466300		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	23908594, 25071141, 25202123, 29059430, 30787639		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	12432273, 16805920, 18597688, 19853943, 20460509, 20587667, 20855924, 21869603, 22105362, 22447278, 23216670, 26247526, 26356670, 26649302, 29059430, 31101800, 32350443 View all (2 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	12692057, 15729718, 18422752, 19934290, 22039425, 22067401, 22146979, 22147942, 22614973, 23959801, 26156586, 31661126, 31951530, 32426915, 36037364	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	1846552	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	15141374, 21307665		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	Pubtator	24422672, 32087612	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	18194454, 25794709, 28284560, 28560380, 30815935, 31852247, 34400880, 35313850, 36698167	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	26620707, 28485808, 31740790	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Intraductal Noninfiltrating	Intraductal noninfiltrating carcinoma	Pubtator	19457236	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Merkel Cell	Merkel cell carcinoma	Pubtator	16498399	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	20853079		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	12460918, 26463718, 29662630, 31285551, 31683461		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	17353198	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	24802662, 28152006, 30048489, 36037364	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	22067401, 23637996	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Transitional Cell	Transitional cell carcinoma	Pubtator	20853079	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardio-facio-cutaneous syndrome	Cardiofaciocutaneous syndrome	BEFREE	17366577, 17981815		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiofaciocutaneous syndrome	Cardiofaciocutaneous syndrome	Pubtator	18039235	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Abnormalities	Cardiovascular Abnormalities	BEFREE	31352898		★★★★★ ★☆☆☆☆ Found in Text Mining only
Central Nervous System Neoplasms	Central Nervous System Neoplasms	BEFREE	21393386		★★★★★ ★☆☆☆☆ Found in Text Mining only
Central Nervous System Neoplasms	Central nervous system neoplasm	Pubtator	21393386	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	12692057	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholesteatoma	Cholesteatoma	BEFREE	15880942		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	Pubtator	31809267	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chromosomal Instability	Chromosomal instability	Pubtator	30359964	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Clear-cell metastatic renal cell carcinoma	Renal Carcinoma	BEFREE	28152006		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	24495750, 28030835, 28378527, 30385823, 30864697		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	25885658	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	17065421, 17908962, 20923857, 22448344, 23934607, 24317328, 24666267, 24691006, 24947927, 25100204, 25589621, 25673644, 25714871, 25920435, 26351322 View all (14 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	BEFREE	12438234, 25322874		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	14742435, 16403224, 18422752, 18451217, 18592002, 19686845, 22773810, 22909976, 23992303, 24330663, 25637165, 25847954, 26660078, 26797410, 27082577 View all (18 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital Heart Defects	Congenital heart defects	BEFREE	31352898		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	30026228		★★★★★ ★☆☆☆☆ Found in Text Mining only
Corticobasal Degeneration	Corticobasal degeneration	Pubtator	23867865	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Costello syndrome (disorder)	Costello syndrome	BEFREE	18042262		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cutaneous Melanoma	Melanoma	BEFREE	16007203, 18945298, 23948972, 24576830		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	Pubtator	34946922	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Deuteranomaly	Deuteranomaly	BEFREE	23867865		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	15118616, 16273242, 22146979		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	22146979, 29426295	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	15299092, 16210010		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	16210010	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy Idiopathic Generalized	Epilepsy	Pubtator	17110434	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epileptic Encephalopathy Early Infantile 3	Developmental and epileptic encephalopathy	Pubtator	31581174	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelioid and spindle cell nevus	Spitz nevus	BEFREE	19788444		★★★★★ ★☆☆☆☆ Found in Text Mining only
Erdheim-Chester Disease	Erdheim-Chester Disease	BEFREE	25324352		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	26646323		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	26646323		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	32945416, 33880577	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty liver	Pubtator	31740790	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosarcoma	Fibrosarcoma	BEFREE	23354306, 26626406		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	Pubtator	22773810, 36921738	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	BEFREE	28539323		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	19082503		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	19458076, 24048798	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	18472967, 19082503		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	20495567, 20533335, 21057530, 31466300		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	22520038, 34433654	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hairy Cell Leukemia	Hairy Cell Leukemia	BEFREE	21663470, 25034364		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis C	Hepatitis c	Pubtator	22114332	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	29059430	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Nonpolyposis Colorectal Cancer	Colorectal Cancer	BEFREE	17065421		★★★★★ ★☆☆☆☆ Found in Text Mining only
Histiocytosis	Histiocytosis	BEFREE	30098202		★★★★★ ★☆☆☆☆ Found in Text Mining only
Histiocytosis, Langerhans-Cell	Histiocytosis	BEFREE	20519626, 24832939, 25324352, 25899310, 28679432, 29768711, 30098202, 30474648		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	21987443, 22078940, 26406991		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperlipidemia	Hyperlipidemia	BEFREE	27232249		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	24117380	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	32426915	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholangiocarcinoma	Intrahepatic Cholangiocarcinoma	BEFREE	30480811		★★★★★ ★☆☆☆☆ Found in Text Mining only
Juvenile Myelomonocytic Leukemia	Myelomonocytic Leukemia	BEFREE	22183880		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ki-1+ Anaplastic Large Cell Lymphoma	Anaplastic Lymphoma	BEFREE	21741362		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	21808062, 22843690	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
LEOPARD Syndrome	LEOPARD Syndrome	BEFREE	22681964		★★★★★ ★☆☆☆☆ Found in Text Mining only
LEOPARD Syndrome	Leopard syndrome	Pubtator	24775816	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	12369851, 18533257, 22562245, 23134356		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	31646826	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Hairy Cell	Hairy cell leukemia	Pubtator	21663470, 23349307	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	24178622, 30799283	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myelomonocytic Juvenile	Myelomonocytic leukemia	Pubtator	18024410	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	24178622, 2653488, 31430364		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	16707376, 21220499, 25195714, 25473899, 25862849, 28000790, 28276530, 28574502, 29423069, 29484394, 29752719, 30146259, 30332648, 30685691, 30784286, 31740790 View all (1 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	LHGDN	17447851		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	LHGDN	18194454		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Neoplasms	Liver neoplasm	Pubtator	31740790	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	32521878, 36321791	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	18422752	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	16951188, 19082503, 20495567		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	23908594, 25071141, 25202123, 29059430, 30787639		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	16273242, 22146979		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	26646323		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	18194454, 21216289		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	12460918, 26463718, 29662630, 31285551, 31484165, 31683461		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	28576749, 30271501		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	20526349, 20853079, 22833462, 24642271, 25809148		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of skin	Skin cancer	BEFREE	23134356		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	21406037		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	20926530, 26892809		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	20853079		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	12781369, 14612909, 15026326, 15488754, 16266992, 16413100, 16489081, 16649144, 17208430, 17442414, 17568777, 18172288, 19037990, 19217204, 20526349 View all (44 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	24495750, 28030835, 28378527, 28951457, 30385823, 30864697		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medullary carcinoma of thyroid	Megalencephaly, Polymicrogyria, Polydactyly, Hydrocephalus Syndrome	BEFREE	18445656		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanocytic nevus	Melanocytic nevus	BEFREE	17518771		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	12460918, 15140228, 15948115, 16129781, 17018604, 17208430, 18323781, 18945298, 20520630, 20526349, 20679910, 21383288, 21527556, 21725359, 21997758 View all (52 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	15140228, 15184373, 16410717, 18008004, 18323781, 19078992, 20350353, 20526349, 20959481, 21383288, 21768778, 21803746, 22310287, 22589389, 22614973 View all (34 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	Pubtator	24762959	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	23817184	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metastatic melanoma	Metastatic Melanoma	BEFREE	21139585, 22614973, 22878367, 23174497, 23276366, 24097822, 24265153, 24957944, 27754804, 28188228, 28719152		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mouth Diseases	Mouth disease	Pubtator	22447278	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mucinous Adenocarcinoma	Mucinous Adenocarcinoma	BEFREE	15141374		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	16234364, 17644731, 18353163, 22556409, 28427158, 29463311, 30846494, 32747568, 32780537	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	18353163, 20568903, 25473899, 28504689, 29463311		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	22169110		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	29364482	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Neoplasms	Nasopharyngeal carcinoma	Pubtator	10929762	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	12447372, 12941809, 14695993, 17183069, 17464312, 17588166, 18422752, 18559533, 19037990, 19082503, 19088048, 19212633, 19788444, 19805051, 19919912 View all (75 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	36135081	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroendocrine Tumors	Neuroendocrine Tumors	BEFREE	31158244		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurofibromatosis 1	Neurofibromatosis	BEFREE	21422080		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurofibrosarcoma	Neurofibrosarcoma	Pubtator	18413802	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nevi and Melanomas	Congenital melanocytic nevus syndrome	BEFREE	19919912		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	31740790		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	12460918, 22131876, 23454899, 25488861, 25801412, 28073102		★★★★★ ★☆☆☆☆ Found in Text Mining only
Noonan Syndrome	Noonan Syndrome	BEFREE	22681964, 23786871, 26670721, 29197556, 30348783		★★★★★ ★☆☆☆☆ Found in Text Mining only
Noonan Syndrome	Noonan syndrome	Pubtator	30348783	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Oculocutaneous albinism type 2	Oculocutaneous albinism	Pubtator	1846552	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	18927278		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	31786886	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	17900261, 26506417, 31124283, 32291856	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	28576749, 30271501		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Cyst	Pancreatic cyst	Pubtator	31576098	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	22628411		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	30913453, 31880394, 33271455, 34476331, 35477123	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	17464312, 18000091, 24240179		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	34946922	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Patent ductus arteriosus	Patent ductus arteriosus	BEFREE	22628411		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peritonitis	Peritonitis	Pubtator	30303876	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pilocytic Astrocytoma	Astrocytoma	BEFREE	21424530, 24470550, 30575814		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pleomorphic Xanthoastrocytoma	Pleomorphic Xanthoastrocytoma	BEFREE	30051528		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Kidney Autosomal Dominant	Polycystic kidney disease	Pubtator	17396115	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	20526349, 20853079, 22833462, 24642271, 25809148		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Intraepithelial Neoplasia	Prostatic intraepithelial neoplasia	Pubtator	32740981	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	20526349, 21871886, 25809148, 28844715, 29898731, 32492656, 32639612, 33277863	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	24642271		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Arterial Hypertension	Pulmonary arterial hypertension	Pubtator	26589479	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	21725359		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	Pubtator	30664191, 34036380	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	BEFREE	29973406		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma Embryonal	Rhabdomyosarcoma	Pubtator	34755412	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	14691295, 21388974, 23354306, 26536389, 28377484, 30314519, 30758881, 31416192		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	Pubtator	30314519	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma Kaposi	Sarcoma	Pubtator	15542692	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma Synovial	Synovial sarcoma	Pubtator	19633425	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Secondary malignant neoplasm of colon and/or rectum	Colorectal Neoplasms	BEFREE	20130433, 25427581, 25589621, 28178681, 29136952, 29530101, 30459076, 31036005		★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin lesion	Skin Lesion	BEFREE	27098388		★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin neoplasm	Pubtator	21274671	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	12509453, 9421477	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Split hand foot deformity 1	Split hand foot deformity	BEFREE	25150293, 25324352		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	36769112	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of skin	Skin carcinoma	BEFREE	24170769		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	26053277		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Diseases	Stomach disease	Pubtator	19037990	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	12854135, 20526349, 27437872, 29141593, 30015980, 33369155, 35566048, 9341140	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
TARSAL-CARPAL COALITION SYNDROME	Tarsal-Carpal Coalition Syndrome	BEFREE	20853079		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid cancer medullary	Medullary thyroid cancer	Pubtator	12509453, 15572361, 8816445	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	17464312, 19255327, 20564403, 36799665	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	16533790, 20926530, 26384551, 26892809		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Carcinoma Anaplastic	Thyroid cancer	Pubtator	31545405	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	20926530, 26892809		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	18799615, 35255601, 37932340	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	32504034	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	34779768	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	20853079, 22049531, 28388658	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	31703640	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal melanoma	Pubtator	16410717, 18985043, 26059332	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Venous Thromboembolism	Venous thromboembolism	Pubtator	39848545	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Waldenstrom Macroglobulinemia	Waldenstrom`s Macroglobulinemia	BEFREE	18533257		★★★★★ ★☆☆☆☆ Found in Text Mining only
Wilms Tumor	Wilms tumor	Pubtator	23922674, 32238401, 36455140	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

ZHX2 (zinc fingers and homeoboxes 2)