Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	2288
Gene name	FKBP prolyl isomerase 4
Gene symbol	FKBP4
Synonyms (NCBI Gene)	FKBP51FKBP52FKBP59HBIHsp56PPIasep52
Chromosome	12
Chromosome location	12p13.33
Summary	The protein encoded by this gene is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. This encoded protein is a cis-trans prolyl isomerase that binds

421

Show/Hide all (421)

miRTarBase ID	miRNA	Experiments	Reference
MIRT050423	hsa-miR-23a-3p	CLASH	23622248
MIRT049584	hsa-miR-92a-3p	CLASH	23622248
MIRT048140	hsa-miR-197-3p	CLASH	23622248
MIRT045461	hsa-miR-149-5p	CLASH	23622248
MIRT045461	hsa-miR-149-5p	CLASH	23622248
MIRT043773	hsa-miR-328-3p	CLASH	23622248
MIRT041945	hsa-miR-484	CLASH	23622248
MIRT040812	hsa-miR-18a-3p	CLASH	23622248
MIRT040589	hsa-miR-92b-3p	CLASH	23622248
MIRT039622	hsa-miR-615-3p	CLASH	23622248
MIRT038526	hsa-miR-99b-3p	CLASH	23622248
MIRT038093	hsa-miR-423-5p	CLASH	23622248
MIRT037530	hsa-miR-744-5p	CLASH	23622248
MIRT037008	hsa-miR-877-3p	CLASH	23622248
MIRT036772	hsa-miR-760	CLASH	23622248
MIRT043773	hsa-miR-328-3p	MicroarrayNext Generation Sequencing (NGS)	28026009
MIRT043773	hsa-miR-328-3p	MicroarrayNext Generation Sequencing (NGS)	28026009
MIRT997420	hsa-miR-1178	CLIP-seq
MIRT997421	hsa-miR-1193	CLIP-seq
MIRT997422	hsa-miR-122	CLIP-seq
MIRT997423	hsa-miR-1224-3p	CLIP-seq
MIRT997424	hsa-miR-1224-5p	CLIP-seq
MIRT997425	hsa-miR-1245b-3p	CLIP-seq
MIRT997426	hsa-miR-1246	CLIP-seq
MIRT997427	hsa-miR-1248	CLIP-seq
MIRT997428	hsa-miR-1252	CLIP-seq
MIRT997429	hsa-miR-1254	CLIP-seq
MIRT997430	hsa-miR-1265	CLIP-seq
MIRT997431	hsa-miR-128	CLIP-seq
MIRT997432	hsa-miR-1284	CLIP-seq
MIRT997433	hsa-miR-1290	CLIP-seq
MIRT997434	hsa-miR-1293	CLIP-seq
MIRT997435	hsa-miR-1299	CLIP-seq
MIRT997436	hsa-miR-1302	CLIP-seq
MIRT997437	hsa-miR-1304	CLIP-seq
MIRT997438	hsa-miR-1323	CLIP-seq
MIRT997439	hsa-miR-137	CLIP-seq
MIRT997440	hsa-miR-140-5p	CLIP-seq
MIRT997441	hsa-miR-1827	CLIP-seq
MIRT997442	hsa-miR-185	CLIP-seq
MIRT997443	hsa-miR-2115	CLIP-seq
MIRT997444	hsa-miR-2392	CLIP-seq
MIRT997445	hsa-miR-2467-3p	CLIP-seq
MIRT997446	hsa-miR-27a	CLIP-seq
MIRT997447	hsa-miR-27b	CLIP-seq
MIRT997448	hsa-miR-3074-5p	CLIP-seq
MIRT997449	hsa-miR-3116	CLIP-seq
MIRT997450	hsa-miR-3122	CLIP-seq
MIRT997451	hsa-miR-3127-3p	CLIP-seq
MIRT997452	hsa-miR-3143	CLIP-seq
MIRT997453	hsa-miR-3144-3p	CLIP-seq
MIRT997454	hsa-miR-3150a-3p	CLIP-seq
MIRT997455	hsa-miR-3151	CLIP-seq
MIRT997456	hsa-miR-3152-5p	CLIP-seq
MIRT997457	hsa-miR-3153	CLIP-seq
MIRT997458	hsa-miR-3157-5p	CLIP-seq
MIRT997459	hsa-miR-3158-3p	CLIP-seq
MIRT997460	hsa-miR-3169	CLIP-seq
MIRT997461	hsa-miR-3175	CLIP-seq
MIRT997462	hsa-miR-3182	CLIP-seq
MIRT997463	hsa-miR-3184	CLIP-seq
MIRT997464	hsa-miR-323-5p	CLIP-seq
MIRT997465	hsa-miR-361-3p	CLIP-seq
MIRT997466	hsa-miR-3617	CLIP-seq
MIRT997467	hsa-miR-3670	CLIP-seq
MIRT997468	hsa-miR-3674	CLIP-seq
MIRT997469	hsa-miR-3678-3p	CLIP-seq
MIRT997470	hsa-miR-3679-3p	CLIP-seq
MIRT997471	hsa-miR-3690	CLIP-seq
MIRT997472	hsa-miR-3692	CLIP-seq
MIRT997473	hsa-miR-371b-5p	CLIP-seq
MIRT997474	hsa-miR-3913-3p	CLIP-seq
MIRT997475	hsa-miR-3913-5p	CLIP-seq
MIRT997476	hsa-miR-3919	CLIP-seq
MIRT997477	hsa-miR-3928	CLIP-seq
MIRT997478	hsa-miR-3929	CLIP-seq
MIRT997479	hsa-miR-425	CLIP-seq
MIRT997480	hsa-miR-4276	CLIP-seq
MIRT997481	hsa-miR-4283	CLIP-seq
MIRT997482	hsa-miR-4286	CLIP-seq
MIRT997483	hsa-miR-4291	CLIP-seq
MIRT997484	hsa-miR-4298	CLIP-seq
MIRT997485	hsa-miR-4305	CLIP-seq
MIRT997486	hsa-miR-4306	CLIP-seq
MIRT997487	hsa-miR-4328	CLIP-seq
MIRT997488	hsa-miR-4419a	CLIP-seq
MIRT997489	hsa-miR-4419b	CLIP-seq
MIRT997490	hsa-miR-4433	CLIP-seq
MIRT997491	hsa-miR-4436b-5p	CLIP-seq
MIRT997492	hsa-miR-4438	CLIP-seq
MIRT997493	hsa-miR-4446-3p	CLIP-seq
MIRT997494	hsa-miR-4450	CLIP-seq
MIRT997495	hsa-miR-4459	CLIP-seq
MIRT997496	hsa-miR-4463	CLIP-seq
MIRT997497	hsa-miR-4478	CLIP-seq
MIRT997498	hsa-miR-4481	CLIP-seq
MIRT997499	hsa-miR-4483	CLIP-seq
MIRT997500	hsa-miR-4489	CLIP-seq
MIRT997501	hsa-miR-4502	CLIP-seq
MIRT997502	hsa-miR-450b-5p	CLIP-seq
MIRT997503	hsa-miR-4510	CLIP-seq
MIRT997504	hsa-miR-4514	CLIP-seq
MIRT997505	hsa-miR-4515	CLIP-seq
MIRT997506	hsa-miR-4533	CLIP-seq
MIRT997507	hsa-miR-4535	CLIP-seq
MIRT997508	hsa-miR-4639-3p	CLIP-seq
MIRT997509	hsa-miR-4644	CLIP-seq
MIRT997510	hsa-miR-4651	CLIP-seq
MIRT997511	hsa-miR-4668-5p	CLIP-seq
MIRT997512	hsa-miR-4691-3p	CLIP-seq
MIRT997513	hsa-miR-4692	CLIP-seq
MIRT997514	hsa-miR-4694-3p	CLIP-seq
MIRT997515	hsa-miR-4697-3p	CLIP-seq
MIRT997516	hsa-miR-4698	CLIP-seq
MIRT997517	hsa-miR-4704-3p	CLIP-seq
MIRT997518	hsa-miR-4722-3p	CLIP-seq
MIRT997519	hsa-miR-4722-5p	CLIP-seq
MIRT997520	hsa-miR-4724-3p	CLIP-seq
MIRT997521	hsa-miR-4726-3p	CLIP-seq
MIRT997522	hsa-miR-4733-3p	CLIP-seq
MIRT997523	hsa-miR-4735-5p	CLIP-seq
MIRT997524	hsa-miR-4738-3p	CLIP-seq
MIRT997525	hsa-miR-4745-5p	CLIP-seq
MIRT997526	hsa-miR-4751	CLIP-seq
MIRT997527	hsa-miR-4760-3p	CLIP-seq
MIRT997528	hsa-miR-4762-3p	CLIP-seq
MIRT997529	hsa-miR-4773	CLIP-seq
MIRT997530	hsa-miR-4782-5p	CLIP-seq
MIRT997531	hsa-miR-485-5p	CLIP-seq
MIRT997532	hsa-miR-486-3p	CLIP-seq
MIRT997533	hsa-miR-490-3p	CLIP-seq
MIRT997534	hsa-miR-491-5p	CLIP-seq
MIRT997535	hsa-miR-492	CLIP-seq
MIRT997536	hsa-miR-495	CLIP-seq
MIRT997537	hsa-miR-507	CLIP-seq
MIRT997538	hsa-miR-5095	CLIP-seq
MIRT997539	hsa-miR-516a-3p	CLIP-seq
MIRT997540	hsa-miR-516b	CLIP-seq
MIRT997541	hsa-miR-520d-5p	CLIP-seq
MIRT997542	hsa-miR-524-5p	CLIP-seq
MIRT997543	hsa-miR-543	CLIP-seq
MIRT997544	hsa-miR-545	CLIP-seq
MIRT997545	hsa-miR-548m	CLIP-seq
MIRT997546	hsa-miR-548o	CLIP-seq
MIRT997547	hsa-miR-548p	CLIP-seq
MIRT997548	hsa-miR-557	CLIP-seq
MIRT997549	hsa-miR-608	CLIP-seq
MIRT997550	hsa-miR-637	CLIP-seq
MIRT997551	hsa-miR-641	CLIP-seq
MIRT997552	hsa-miR-665	CLIP-seq
MIRT997553	hsa-miR-765	CLIP-seq
MIRT997554	hsa-miR-875-3p	CLIP-seq
MIRT997555	hsa-miR-875-5p	CLIP-seq
MIRT997556	hsa-miR-888	CLIP-seq
MIRT997557	hsa-miR-939	CLIP-seq
MIRT997420	hsa-miR-1178	CLIP-seq
MIRT997422	hsa-miR-122	CLIP-seq
MIRT997423	hsa-miR-1224-3p	CLIP-seq
MIRT1995718	hsa-miR-1226	CLIP-seq
MIRT997429	hsa-miR-1254	CLIP-seq
MIRT997431	hsa-miR-128	CLIP-seq
MIRT997433	hsa-miR-1290	CLIP-seq
MIRT997437	hsa-miR-1304	CLIP-seq
MIRT997438	hsa-miR-1323	CLIP-seq
MIRT997439	hsa-miR-137	CLIP-seq
MIRT997440	hsa-miR-140-5p	CLIP-seq
MIRT997441	hsa-miR-1827	CLIP-seq
MIRT1995719	hsa-miR-2117	CLIP-seq
MIRT1995720	hsa-miR-2355-5p	CLIP-seq
MIRT997445	hsa-miR-2467-3p	CLIP-seq
MIRT997446	hsa-miR-27a	CLIP-seq
MIRT997447	hsa-miR-27b	CLIP-seq
MIRT1995721	hsa-miR-29a	CLIP-seq
MIRT1995722	hsa-miR-29b	CLIP-seq
MIRT1995723	hsa-miR-29c	CLIP-seq
MIRT997449	hsa-miR-3116	CLIP-seq
MIRT997450	hsa-miR-3122	CLIP-seq
MIRT997451	hsa-miR-3127-3p	CLIP-seq
MIRT997454	hsa-miR-3150a-3p	CLIP-seq
MIRT997458	hsa-miR-3157-5p	CLIP-seq
MIRT997459	hsa-miR-3158-3p	CLIP-seq
MIRT997461	hsa-miR-3175	CLIP-seq
MIRT997463	hsa-miR-3184	CLIP-seq
MIRT1995724	hsa-miR-3612	CLIP-seq
MIRT997465	hsa-miR-361-3p	CLIP-seq
MIRT997466	hsa-miR-3617	CLIP-seq
MIRT1995725	hsa-miR-3662	CLIP-seq
MIRT997469	hsa-miR-3678-3p	CLIP-seq
MIRT997470	hsa-miR-3679-3p	CLIP-seq
MIRT997471	hsa-miR-3690	CLIP-seq
MIRT997472	hsa-miR-3692	CLIP-seq
MIRT997473	hsa-miR-371b-5p	CLIP-seq
MIRT997474	hsa-miR-3913-3p	CLIP-seq
MIRT997475	hsa-miR-3913-5p	CLIP-seq
MIRT997476	hsa-miR-3919	CLIP-seq
MIRT997477	hsa-miR-3928	CLIP-seq
MIRT997478	hsa-miR-3929	CLIP-seq
MIRT1995726	hsa-miR-3978	CLIP-seq
MIRT1995727	hsa-miR-4277	CLIP-seq
MIRT997482	hsa-miR-4286	CLIP-seq
MIRT997483	hsa-miR-4291	CLIP-seq
MIRT997487	hsa-miR-4328	CLIP-seq
MIRT997489	hsa-miR-4419b	CLIP-seq
MIRT997490	hsa-miR-4433	CLIP-seq
MIRT997491	hsa-miR-4436b-5p	CLIP-seq
MIRT1995728	hsa-miR-4443	CLIP-seq
MIRT997493	hsa-miR-4446-3p	CLIP-seq
MIRT1995729	hsa-miR-4446-5p	CLIP-seq
MIRT997494	hsa-miR-4450	CLIP-seq
MIRT997497	hsa-miR-4478	CLIP-seq
MIRT997498	hsa-miR-4481	CLIP-seq
MIRT997504	hsa-miR-4514	CLIP-seq
MIRT997507	hsa-miR-4535	CLIP-seq
MIRT997512	hsa-miR-4691-3p	CLIP-seq
MIRT997513	hsa-miR-4692	CLIP-seq
MIRT997516	hsa-miR-4698	CLIP-seq
MIRT997517	hsa-miR-4704-3p	CLIP-seq
MIRT1995730	hsa-miR-4717-3p	CLIP-seq
MIRT1995731	hsa-miR-4717-5p	CLIP-seq
MIRT997519	hsa-miR-4722-5p	CLIP-seq
MIRT997521	hsa-miR-4726-3p	CLIP-seq
MIRT997525	hsa-miR-4745-5p	CLIP-seq
MIRT997529	hsa-miR-4773	CLIP-seq
MIRT1995732	hsa-miR-4802-3p	CLIP-seq
MIRT1995733	hsa-miR-4802-5p	CLIP-seq
MIRT997531	hsa-miR-485-5p	CLIP-seq
MIRT997532	hsa-miR-486-3p	CLIP-seq
MIRT997534	hsa-miR-491-5p	CLIP-seq
MIRT997535	hsa-miR-492	CLIP-seq
MIRT997541	hsa-miR-520d-5p	CLIP-seq
MIRT997542	hsa-miR-524-5p	CLIP-seq
MIRT997544	hsa-miR-545	CLIP-seq
MIRT997546	hsa-miR-548o	CLIP-seq
MIRT997550	hsa-miR-637	CLIP-seq
MIRT997551	hsa-miR-641	CLIP-seq
MIRT1995734	hsa-miR-650	CLIP-seq
MIRT997556	hsa-miR-888	CLIP-seq
MIRT997557	hsa-miR-939	CLIP-seq
MIRT2229715	hsa-miR-1206	CLIP-seq
MIRT997422	hsa-miR-122	CLIP-seq
MIRT997423	hsa-miR-1224-3p	CLIP-seq
MIRT2229716	hsa-miR-1231	CLIP-seq
MIRT997428	hsa-miR-1252	CLIP-seq
MIRT997429	hsa-miR-1254	CLIP-seq
MIRT997431	hsa-miR-128	CLIP-seq
MIRT997432	hsa-miR-1284	CLIP-seq
MIRT997434	hsa-miR-1293	CLIP-seq
MIRT997435	hsa-miR-1299	CLIP-seq
MIRT997437	hsa-miR-1304	CLIP-seq
MIRT997438	hsa-miR-1323	CLIP-seq
MIRT997440	hsa-miR-140-5p	CLIP-seq
MIRT997441	hsa-miR-1827	CLIP-seq
MIRT997442	hsa-miR-185	CLIP-seq
MIRT2229717	hsa-miR-19a	CLIP-seq
MIRT2229718	hsa-miR-19b	CLIP-seq
MIRT1995720	hsa-miR-2355-5p	CLIP-seq
MIRT997445	hsa-miR-2467-3p	CLIP-seq
MIRT997446	hsa-miR-27a	CLIP-seq
MIRT997447	hsa-miR-27b	CLIP-seq
MIRT2229719	hsa-miR-296-3p	CLIP-seq
MIRT997449	hsa-miR-3116	CLIP-seq
MIRT997451	hsa-miR-3127-3p	CLIP-seq
MIRT997452	hsa-miR-3143	CLIP-seq
MIRT2229720	hsa-miR-3147	CLIP-seq
MIRT997454	hsa-miR-3150a-3p	CLIP-seq
MIRT997457	hsa-miR-3153	CLIP-seq
MIRT997458	hsa-miR-3157-5p	CLIP-seq
MIRT997459	hsa-miR-3158-3p	CLIP-seq
MIRT997460	hsa-miR-3169	CLIP-seq
MIRT997461	hsa-miR-3175	CLIP-seq
MIRT997462	hsa-miR-3182	CLIP-seq
MIRT997463	hsa-miR-3184	CLIP-seq
MIRT2229721	hsa-miR-320e	CLIP-seq
MIRT997464	hsa-miR-323-5p	CLIP-seq
MIRT2229722	hsa-miR-323b-5p	CLIP-seq
MIRT2229723	hsa-miR-3607-5p	CLIP-seq
MIRT1995724	hsa-miR-3612	CLIP-seq
MIRT997465	hsa-miR-361-3p	CLIP-seq
MIRT997466	hsa-miR-3617	CLIP-seq
MIRT2229724	hsa-miR-3660	CLIP-seq
MIRT997467	hsa-miR-3670	CLIP-seq
MIRT997469	hsa-miR-3678-3p	CLIP-seq
MIRT997470	hsa-miR-3679-3p	CLIP-seq
MIRT997471	hsa-miR-3690	CLIP-seq
MIRT997473	hsa-miR-371b-5p	CLIP-seq
MIRT997474	hsa-miR-3913-3p	CLIP-seq
MIRT997476	hsa-miR-3919	CLIP-seq
MIRT997477	hsa-miR-3928	CLIP-seq
MIRT997482	hsa-miR-4286	CLIP-seq
MIRT2229725	hsa-miR-4288	CLIP-seq
MIRT997483	hsa-miR-4291	CLIP-seq
MIRT997486	hsa-miR-4306	CLIP-seq
MIRT997487	hsa-miR-4328	CLIP-seq
MIRT997488	hsa-miR-4419a	CLIP-seq
MIRT2229726	hsa-miR-4425	CLIP-seq
MIRT997490	hsa-miR-4433	CLIP-seq
MIRT1995728	hsa-miR-4443	CLIP-seq
MIRT997493	hsa-miR-4446-3p	CLIP-seq
MIRT1995729	hsa-miR-4446-5p	CLIP-seq
MIRT997496	hsa-miR-4463	CLIP-seq
MIRT997498	hsa-miR-4481	CLIP-seq
MIRT997499	hsa-miR-4483	CLIP-seq
MIRT997501	hsa-miR-4502	CLIP-seq
MIRT997503	hsa-miR-4510	CLIP-seq
MIRT997504	hsa-miR-4514	CLIP-seq
MIRT997505	hsa-miR-4515	CLIP-seq
MIRT2229727	hsa-miR-4526	CLIP-seq
MIRT997506	hsa-miR-4533	CLIP-seq
MIRT997507	hsa-miR-4535	CLIP-seq
MIRT997509	hsa-miR-4644	CLIP-seq
MIRT997510	hsa-miR-4651	CLIP-seq
MIRT2229728	hsa-miR-4656	CLIP-seq
MIRT2229729	hsa-miR-4659a-3p	CLIP-seq
MIRT2229730	hsa-miR-4659b-3p	CLIP-seq
MIRT997511	hsa-miR-4668-5p	CLIP-seq
MIRT997512	hsa-miR-4691-3p	CLIP-seq
MIRT997513	hsa-miR-4692	CLIP-seq
MIRT997516	hsa-miR-4698	CLIP-seq
MIRT997517	hsa-miR-4704-3p	CLIP-seq
MIRT997519	hsa-miR-4722-5p	CLIP-seq
MIRT997521	hsa-miR-4726-3p	CLIP-seq
MIRT997523	hsa-miR-4735-5p	CLIP-seq
MIRT997524	hsa-miR-4738-3p	CLIP-seq
MIRT997525	hsa-miR-4745-5p	CLIP-seq
MIRT997527	hsa-miR-4760-3p	CLIP-seq
MIRT997528	hsa-miR-4762-3p	CLIP-seq
MIRT997529	hsa-miR-4773	CLIP-seq
MIRT2229731	hsa-miR-4777-5p	CLIP-seq
MIRT997530	hsa-miR-4782-5p	CLIP-seq
MIRT1995733	hsa-miR-4802-5p	CLIP-seq
MIRT997532	hsa-miR-486-3p	CLIP-seq
MIRT997533	hsa-miR-490-3p	CLIP-seq
MIRT997534	hsa-miR-491-5p	CLIP-seq
MIRT997535	hsa-miR-492	CLIP-seq
MIRT997540	hsa-miR-516b	CLIP-seq
MIRT997541	hsa-miR-520d-5p	CLIP-seq
MIRT997542	hsa-miR-524-5p	CLIP-seq
MIRT997543	hsa-miR-543	CLIP-seq
MIRT997544	hsa-miR-545	CLIP-seq
MIRT997545	hsa-miR-548m	CLIP-seq
MIRT997546	hsa-miR-548o	CLIP-seq
MIRT997547	hsa-miR-548p	CLIP-seq
MIRT2229732	hsa-miR-550b	CLIP-seq
MIRT997549	hsa-miR-608	CLIP-seq
MIRT2229733	hsa-miR-632	CLIP-seq
MIRT997550	hsa-miR-637	CLIP-seq
MIRT997551	hsa-miR-641	CLIP-seq
MIRT2229734	hsa-miR-645	CLIP-seq
MIRT1995734	hsa-miR-650	CLIP-seq
MIRT997553	hsa-miR-765	CLIP-seq
MIRT997554	hsa-miR-875-3p	CLIP-seq
MIRT997556	hsa-miR-888	CLIP-seq
MIRT997557	hsa-miR-939	CLIP-seq
MIRT997477	hsa-miR-3928	CLIP-seq
MIRT997517	hsa-miR-4704-3p	CLIP-seq
MIRT997423	hsa-miR-1224-3p	CLIP-seq
MIRT1995718	hsa-miR-1226	CLIP-seq
MIRT2533661	hsa-miR-1269	CLIP-seq
MIRT2533662	hsa-miR-1269b	CLIP-seq
MIRT2533663	hsa-miR-1288	CLIP-seq
MIRT997434	hsa-miR-1293	CLIP-seq
MIRT997440	hsa-miR-140-5p	CLIP-seq
MIRT1995720	hsa-miR-2355-5p	CLIP-seq
MIRT1995721	hsa-miR-29a	CLIP-seq
MIRT1995722	hsa-miR-29b	CLIP-seq
MIRT1995723	hsa-miR-29c	CLIP-seq
MIRT997451	hsa-miR-3127-3p	CLIP-seq
MIRT997458	hsa-miR-3157-5p	CLIP-seq
MIRT997464	hsa-miR-323-5p	CLIP-seq
MIRT1995724	hsa-miR-3612	CLIP-seq
MIRT997465	hsa-miR-361-3p	CLIP-seq
MIRT997466	hsa-miR-3617	CLIP-seq
MIRT1995725	hsa-miR-3662	CLIP-seq
MIRT997470	hsa-miR-3679-3p	CLIP-seq
MIRT997474	hsa-miR-3913-3p	CLIP-seq
MIRT997477	hsa-miR-3928	CLIP-seq
MIRT1995726	hsa-miR-3978	CLIP-seq
MIRT997482	hsa-miR-4286	CLIP-seq
MIRT1995728	hsa-miR-4443	CLIP-seq
MIRT1995729	hsa-miR-4446-5p	CLIP-seq
MIRT997499	hsa-miR-4483	CLIP-seq
MIRT997505	hsa-miR-4515	CLIP-seq
MIRT997510	hsa-miR-4651	CLIP-seq
MIRT997512	hsa-miR-4691-3p	CLIP-seq
MIRT997514	hsa-miR-4694-3p	CLIP-seq
MIRT1995730	hsa-miR-4717-3p	CLIP-seq
MIRT1995731	hsa-miR-4717-5p	CLIP-seq
MIRT2533664	hsa-miR-4740-5p	CLIP-seq
MIRT997529	hsa-miR-4773	CLIP-seq
MIRT1995732	hsa-miR-4802-3p	CLIP-seq
MIRT1995733	hsa-miR-4802-5p	CLIP-seq
MIRT997545	hsa-miR-548m	CLIP-seq
MIRT997549	hsa-miR-608	CLIP-seq
MIRT997551	hsa-miR-641	CLIP-seq
MIRT1995734	hsa-miR-650	CLIP-seq
MIRT997423	hsa-miR-1224-3p	CLIP-seq
MIRT1995718	hsa-miR-1226	CLIP-seq
MIRT997440	hsa-miR-140-5p	CLIP-seq
MIRT1995720	hsa-miR-2355-5p	CLIP-seq
MIRT1995721	hsa-miR-29a	CLIP-seq
MIRT1995722	hsa-miR-29b	CLIP-seq
MIRT1995723	hsa-miR-29c	CLIP-seq
MIRT997451	hsa-miR-3127-3p	CLIP-seq
MIRT997458	hsa-miR-3157-5p	CLIP-seq
MIRT1995724	hsa-miR-3612	CLIP-seq
MIRT997465	hsa-miR-361-3p	CLIP-seq
MIRT997466	hsa-miR-3617	CLIP-seq
MIRT1995725	hsa-miR-3662	CLIP-seq
MIRT997470	hsa-miR-3679-3p	CLIP-seq
MIRT997474	hsa-miR-3913-3p	CLIP-seq
MIRT997477	hsa-miR-3928	CLIP-seq
MIRT997482	hsa-miR-4286	CLIP-seq
MIRT1995728	hsa-miR-4443	CLIP-seq
MIRT1995729	hsa-miR-4446-5p	CLIP-seq
MIRT997512	hsa-miR-4691-3p	CLIP-seq
MIRT1995730	hsa-miR-4717-3p	CLIP-seq
MIRT997529	hsa-miR-4773	CLIP-seq
MIRT1995732	hsa-miR-4802-3p	CLIP-seq
MIRT1995733	hsa-miR-4802-5p	CLIP-seq
MIRT997551	hsa-miR-641	CLIP-seq
MIRT1995734	hsa-miR-650	CLIP-seq

Show/Hide all (2)

Transcription factor	Regulation	Reference
AR	Unknown	23192983
HSF1	Unknown	20692357

Show/Hide all (52)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003723	Function	RNA binding	HDA	22658674
GO:0003755	Function	Peptidyl-prolyl cis-trans isomerase activity	IBA
GO:0003755	Function	Peptidyl-prolyl cis-trans isomerase activity	IDA	11350175
GO:0003755	Function	Peptidyl-prolyl cis-trans isomerase activity	IEA
GO:0005515	Function	Protein binding	IPI	11583998, 12604780, 14638689, 19875381, 20133804, 20188096, 21170051, 21360678, 21730179, 23741051, 25036637, 25277244, 28514442, 32296183, 33961781, 35063084
GO:0005524	Function	ATP binding	IEA
GO:0005525	Function	GTP binding	IEA
GO:0005528	Function	FK506 binding	IEA
GO:0005528	Function	FK506 binding	TAS	1376003
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	TAS	2378870
GO:0005739	Component	Mitochondrion	IEA
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	ISS
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IEA
GO:0005874	Component	Microtubule	IEA
GO:0006457	Process	Protein folding	IBA
GO:0006457	Process	Protein folding	IDA	11350175
GO:0006457	Process	Protein folding	TAS	1279700
GO:0006463	Process	Steroid hormone receptor complex assembly	IEA
GO:0006825	Process	Copper ion transport	IEA
GO:0007566	Process	Embryo implantation	IEA
GO:0010977	Process	Negative regulation of neuron projection development	ISS
GO:0016853	Function	Isomerase activity	IEA
GO:0030424	Component	Axon	IEA
GO:0030521	Process	Androgen receptor signaling pathway	IEA
GO:0030674	Function	Protein-macromolecule adaptor activity	TAS	2378870
GO:0030850	Process	Prostate gland development	IEA
GO:0031072	Function	Heat shock protein binding	IEA
GO:0031072	Function	Heat shock protein binding	IPI	9660753
GO:0031111	Process	Negative regulation of microtubule polymerization or depolymerization	ISS
GO:0031115	Process	Negative regulation of microtubule polymerization	IEA
GO:0031503	Process	Protein-containing complex localization	IEA
GO:0032767	Function	Copper-dependent protein binding	IEA
GO:0032991	Component	Protein-containing complex	IEA
GO:0035259	Function	Nuclear glucocorticoid receptor binding	IEA
GO:0042995	Component	Cell projection	IEA
GO:0043025	Component	Neuronal cell body	IEA
GO:0044295	Component	Axonal growth cone	IEA
GO:0044295	Component	Axonal growth cone	ISS
GO:0046661	Process	Male sex differentiation	IEA
GO:0048156	Function	Tau protein binding	IEA
GO:0048471	Component	Perinuclear region of cytoplasm	IEA
GO:0048608	Process	Reproductive structure development	IEA
GO:0051219	Function	Phosphoprotein binding	IEA
GO:0070062	Component	Extracellular exosome	HDA	19056867, 20458337

MIM	HGNC	e!Ensembl
600611	3720	ENSG00000004478

Q02790

Protein name

Peptidyl-prolyl cis-trans isomerase FKBP4 (PPIase FKBP4) (EC 5.2.1.8) (51 kDa FK506-binding protein) (FKBP51) (52 kDa FK506-binding protein) (52 kDa FKBP) (FKBP-52) (59 kDa immunophilin) (p59) (FK506-binding protein 4) (FKBP-4) (FKBP59) (HSP-binding immun

Protein function

Immunophilin protein with PPIase and co-chaperone activities. Component of steroid receptors heterocomplexes through interaction with heat-shock protein 90 (HSP90). May play a role in the intracellular trafficking of heterooligomeric forms of st

PDB

1N1A , 1P5Q , 1Q1C , 1QZ2 , 4DRJ , 4LAV , 4LAW , 4LAX , 4LAY , 4TW8 , 6RCY , 8FFV

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00254	FKBP_C	43 → 135	FKBP-type peptidyl-prolyl cis-trans isomerase	Domain
PF00254	FKBP_C	160 → 250	FKBP-type peptidyl-prolyl cis-trans isomerase	Domain
PF00515	TPR_1	320 → 352	Tetratricopeptide repeat	Repeat

Tissue specificity

TISSUE SPECIFICITY: Widely expressed. {ECO:0000269|PubMed:1279700}.

Sequence

MTAEEMKATESGAQSAPLPMEGVDISPKQDEGVLKVIKREGTGTEMPMIGDRVFVHYTGW
LLDGTKFDSSLDRKDKFSFDLGKGEVIKAWDIAIATMKVGEVCHITCKPEYAYGSAGSPP
KIPPNATLVFEVELFEFKGEDLTEEEDGGIIRRIQTRGEGYAKPNEGAIVEVALEGYYKD
KLFDQRELRFEIGEGENLDLPYGLERAIQRMEKGEHSIVYLKPSYAFGSVGKEKFQIPPN
AELKYELHLKSFEKAKESWEMNSEEKLEQSTIVKERGTVYFKEGKYKQALLQYKKIVSWL
EYESSFSNEEAQKAQALRLASHLNLAMCHLKLQAFSAAIESCNKALELDSNNEKGLFRRG
EAHLAVNDFELARADFQKVLQLYPNNKAAKTQLAVCQQRIRRQLAREKKLYANMFERLAE
EENKAKAEASSGDHPTDTEMKEEQKSNTAGSQSQVETEA

Sequence length

459

Interactions

View interactions

	KEGG		Reactome
	Estrogen signaling pathway		HSP90 chaperone cycle for steroid hormone receptors (SHR) Attenuation phase ESR-mediated signaling Estrogen-dependent gene expression

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (5)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
FKBP4-related disorder	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOGONADISM	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TESTICULAR DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UNIPOLAR DEPRESSION	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (116)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma	Adenocarcinoma	BEFREE	18443959, 19502791, 29113312		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of colon	Adenocarcinoma Of Colon	BEFREE	18443959		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma Of Esophagus	Esophageal Cancer	BEFREE	20332323		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of large intestine	Colorectal Cancer	BEFREE	18443959		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Hodgkin Lymphoma	Hodgkin Lymphoma	BEFREE	26988706		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	BEFREE	27193821		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	28011744		★★★★★ ★☆☆☆☆ Found in Text Mining only
AMYOTROPHIC LATERAL SCLEROSIS 1	Lateral Sclerosis	BEFREE	10077670		★★★★★ ★☆☆☆☆ Found in Text Mining only
Androgen Insensitivity Syndrome	Androgen insensitivity syndrome	Pubtator	33182400	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia, Sickle Cell	Anemia	BEFREE	30308028		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	30310158, 30585227		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	30310158, 30585227		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Valve Insufficiency	Aortic Valve Insufficiency	BEFREE	20048054, 20210997, 28252832		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	20156738, 20853021, 23762334		★★★★★ ★☆☆☆☆ Found in Text Mining only
Azoospermia	Azoospermia	BEFREE	20210997		★★★★★ ★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet disease	Pubtator	39278467	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	30604907		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	11374893, 19584157, 24927296, 28190248, 29113172, 31202267, 31660083		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	19228724, 24927296, 32814092, 35394865	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cap Myopathy	Cap myopathy	Pubtator	28852180	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	15365563		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	Pubtator	31467233	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	30604907		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	25204737		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	20156738		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	8311838		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	15004035	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital contractural arachnodactyly	Congenital Contractural Arachnodactyly	BEFREE	25170898		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	29935727		★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	28245260, 28246482, 28453763, 29562271, 30541015, 31532265		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	20726698, 22548329, 22581765, 25386878, 25666308, 29524264, 29893552, 30669684		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive Disorder Major	Major depressive disorder	Pubtator	19199039, 20726698	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	30669684, 31541100		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	30669684, 31541100		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	30032404, 31668388		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	25636172, 28256087		★★★★★ ★☆☆☆☆ Found in Text Mining only
Disorders of Sex Development	Disorders of sex development	Pubtator	33182400	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dysautonomia, Familial	Dysautonomia	BEFREE	21793190		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial adenocarcinoma	Endometrial Adenocarcinoma	BEFREE	29113312		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	33464989	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	18988805, 27778641		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	33464989	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Eosinophilia	Eosinophilia	BEFREE	23762334		★★★★★ ★☆☆☆☆ Found in Text Mining only
Eosinophilic esophagitis	Eosinophilia	BEFREE	20371398		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	25204737		★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial multiple trichoepitheliomata	Multiple Trichoepithelioma	BEFREE	20332323		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibroadenoma	Fibroadenoma	BEFREE	15365563		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastritis	Gastritis	BEFREE	27196595		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	28978117, 30794467, 30940658		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	28978117, 30794467, 30940658		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	28978117		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glucocorticoid Receptor Deficiency	Glucocorticoid Receptor Deficiency	BEFREE	20156738, 30702561		★★★★★ ★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves Disease	BEFREE	27929668		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	26988706		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypospadias	Hypospadias	BEFREE	17343741, 20605780		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypospadias	Hypospadias	Pubtator	17343741	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ki-1+ Anaplastic Large Cell Lymphoma	Anaplastic Lymphoma	BEFREE	16108830		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	11103774		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	LHGDN	12603528		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	20807235		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	33354489	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, T-Cell, Cutaneous	Lymphoma	BEFREE	24908319, 28977697		★★★★★ ★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	19199039, 19545546, 20726698, 25436518, 30585227, 31800244		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Major Depressive Disorder	Mental Depression	PSYGENET_DG	19199039, 19545546, 20726698		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant neoplasm of breast	Breast Cancer	BEFREE	19584157, 24927296, 28190248, 29113172, 31202267, 31660083		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	28363942, 30770779		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	15131019, 15821585, 20023700, 27718274, 28032931, 28252832, 29484655, 9679983		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	15753984		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	30604907		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	15753984, 19696786, 19732725, 21514887, 21530399, 21565553, 26074449, 26112410, 27592546, 27718274, 28190248, 28977697, 30641296, 31754722, 9679983		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	29113172		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	19696786, 23559012, 25895097, 25942396, 28032931, 30451787		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	20726698, 22548329, 22581765, 25386878, 25666308, 29524264, 29893552, 30669684		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental disorders	Mental Disorders	BEFREE	19199039, 24040820, 25436518, 27829158, 30169894, 30483074, 31668388		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	30669684, 31668388		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	31668388		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	20489733	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood Disorder	BEFREE	22581765, 25386878		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	14576816, 19502791, 19696786, 20048054, 21530399, 21565553, 25895097, 25942396, 27196595, 28218707, 28434031, 28978117, 29113172, 29484655, 29666445, 30451787, 30546435, 31660083 View all (3 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	10336507		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	30669684, 31668388		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ocular Hypertension	Ocular Hypertension	BEFREE	22921020		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteitis Deformans	Paget disease	BEFREE	28524179		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteopetrosis	Osteopetrosis	BEFREE	26178921		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	28363942		★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	30546435		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	20442138, 27981472, 31830361		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	38203854	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Penile hypospadias	Penile Hypospadias	BEFREE	17343741, 20605780		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	28646565		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	26493122, 30483787		★★★★★ ★☆☆☆☆ Found in Text Mining only
Post-Traumatic Stress Disorder	Stress Disorder	BEFREE	22548329, 29893552, 30585227, 30669684		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary Myelofibrosis	Myelofibrosis	BEFREE	12351405, 15089760		★★★★★ ★☆☆☆☆ Found in Text Mining only
Progesterone Resistance	Progesterone Resistance	BEFREE	12746298		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	15131019, 15821585, 20023700, 27718274, 28032931, 28252832, 29484655, 9679983		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	15131019		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	17615153	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	34057812	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	29935727		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rotator cuff syndrome	Rotator cuff syndrome	BEFREE	30518018		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	31296417		★★★★★ ★☆☆☆☆ Found in Text Mining only
Seminoma	Seminoma	BEFREE	22068818		★★★★★ ★☆☆☆☆ Found in Text Mining only
Seminoma	Seminoma	Pubtator	22068818	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sleep Disorders	Sleep Disorders	BEFREE	24354785		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	28218707		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	20162572		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	15753984		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Diseases	Stomach Diseases	BEFREE	29148176		★★★★★ ★☆☆☆☆ Found in Text Mining only
T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	14576816		★★★★★ ★☆☆☆☆ Found in Text Mining only
Tauopathies	Tauopathies	BEFREE	22233767, 23999428, 24623856		★★★★★ ★☆☆☆☆ Found in Text Mining only
Testicular Neoplasms	Testicular neoplasm	Pubtator	22068818	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	29801480, 31660083		★★★★★ ★☆☆☆☆ Found in Text Mining only
Unipolar Depression	Mental Depression	BEFREE	19199039, 19545546, 25436518, 31800244		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Unipolar Depression	Mental Depression	PSYGENET_DG	19199039, 19545546, 20726698		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uveal melanoma	Uveal Melanoma	BEFREE	31612319		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vitamin D Deficiency	Vitamin D Deficiency	BEFREE	27603182		★★★★★ ★☆☆☆☆ Found in Text Mining only

FKBP4 (FKBP prolyl isomerase 4)