Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	2287
Gene name	FKBP prolyl isomerase 3
Gene symbol	FKBP3
Synonyms (NCBI Gene)	FKBP-25FKBP-3FKBP25PPIase
Chromosome	14
Chromosome location	14q21.2
Summary	The protein encoded by this gene is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. This encoded protein is a cis-trans prolyl isomerase that binds

Show/Hide all (91)

miRTarBase ID	miRNA	Experiments	Reference
MIRT021002	hsa-miR-155-5p	Proteomics	18668040
MIRT027824	hsa-miR-98-5p	Microarray	19088304
MIRT038728	hsa-miR-93-3p	CLASH	23622248
MIRT997388	hsa-let-7a	CLIP-seq
MIRT997389	hsa-let-7b	CLIP-seq
MIRT997390	hsa-let-7c	CLIP-seq
MIRT997391	hsa-let-7d	CLIP-seq
MIRT997392	hsa-let-7e	CLIP-seq
MIRT997393	hsa-let-7f	CLIP-seq
MIRT997394	hsa-let-7g	CLIP-seq
MIRT997395	hsa-let-7i	CLIP-seq
MIRT997396	hsa-miR-202	CLIP-seq
MIRT997397	hsa-miR-3148	CLIP-seq
MIRT997398	hsa-miR-3168	CLIP-seq
MIRT997399	hsa-miR-362-5p	CLIP-seq
MIRT997400	hsa-miR-3684	CLIP-seq
MIRT997401	hsa-miR-3922-5p	CLIP-seq
MIRT997402	hsa-miR-3941	CLIP-seq
MIRT997403	hsa-miR-4289	CLIP-seq
MIRT997404	hsa-miR-4458	CLIP-seq
MIRT997405	hsa-miR-4480	CLIP-seq
MIRT997406	hsa-miR-4496	CLIP-seq
MIRT997407	hsa-miR-4500	CLIP-seq
MIRT997408	hsa-miR-4639-5p	CLIP-seq
MIRT997409	hsa-miR-4659a-3p	CLIP-seq
MIRT997410	hsa-miR-4659b-3p	CLIP-seq
MIRT997411	hsa-miR-466	CLIP-seq
MIRT997412	hsa-miR-4672	CLIP-seq
MIRT997413	hsa-miR-4753-5p	CLIP-seq
MIRT997414	hsa-miR-500b	CLIP-seq
MIRT997415	hsa-miR-501-5p	CLIP-seq
MIRT997416	hsa-miR-513a-3p	CLIP-seq
MIRT997417	hsa-miR-548l	CLIP-seq
MIRT997418	hsa-miR-889	CLIP-seq
MIRT997419	hsa-miR-98	CLIP-seq
MIRT1995710	hsa-miR-1236	CLIP-seq
MIRT1995711	hsa-miR-145	CLIP-seq
MIRT997398	hsa-miR-3168	CLIP-seq
MIRT1995712	hsa-miR-3180-5p	CLIP-seq
MIRT1995713	hsa-miR-338-5p	CLIP-seq
MIRT1995714	hsa-miR-3675-3p	CLIP-seq
MIRT997401	hsa-miR-3922-5p	CLIP-seq
MIRT997402	hsa-miR-3941	CLIP-seq
MIRT1995715	hsa-miR-4279	CLIP-seq
MIRT997405	hsa-miR-4480	CLIP-seq
MIRT997406	hsa-miR-4496	CLIP-seq
MIRT1995716	hsa-miR-4522	CLIP-seq
MIRT997409	hsa-miR-4659a-3p	CLIP-seq
MIRT997410	hsa-miR-4659b-3p	CLIP-seq
MIRT997411	hsa-miR-466	CLIP-seq
MIRT997412	hsa-miR-4672	CLIP-seq
MIRT997413	hsa-miR-4753-5p	CLIP-seq
MIRT997416	hsa-miR-513a-3p	CLIP-seq
MIRT997417	hsa-miR-548l	CLIP-seq
MIRT1995717	hsa-miR-802	CLIP-seq
MIRT1995710	hsa-miR-1236	CLIP-seq
MIRT2229711	hsa-miR-128	CLIP-seq
MIRT1995711	hsa-miR-145	CLIP-seq
MIRT2229712	hsa-miR-27a	CLIP-seq
MIRT2229713	hsa-miR-27b	CLIP-seq
MIRT997398	hsa-miR-3168	CLIP-seq
MIRT1995712	hsa-miR-3180-5p	CLIP-seq
MIRT1995713	hsa-miR-338-5p	CLIP-seq
MIRT2229714	hsa-miR-3681	CLIP-seq
MIRT997400	hsa-miR-3684	CLIP-seq
MIRT997402	hsa-miR-3941	CLIP-seq
MIRT997406	hsa-miR-4496	CLIP-seq
MIRT1995716	hsa-miR-4522	CLIP-seq
MIRT997411	hsa-miR-466	CLIP-seq
MIRT997412	hsa-miR-4672	CLIP-seq
MIRT997416	hsa-miR-513a-3p	CLIP-seq
MIRT997417	hsa-miR-548l	CLIP-seq
MIRT1995717	hsa-miR-802	CLIP-seq
MIRT1995710	hsa-miR-1236	CLIP-seq
MIRT997398	hsa-miR-3168	CLIP-seq
MIRT1995713	hsa-miR-338-5p	CLIP-seq
MIRT997401	hsa-miR-3922-5p	CLIP-seq
MIRT997403	hsa-miR-4289	CLIP-seq
MIRT997405	hsa-miR-4480	CLIP-seq
MIRT1995716	hsa-miR-4522	CLIP-seq
MIRT997409	hsa-miR-4659a-3p	CLIP-seq
MIRT997410	hsa-miR-4659b-3p	CLIP-seq
MIRT997413	hsa-miR-4753-5p	CLIP-seq
MIRT997416	hsa-miR-513a-3p	CLIP-seq
MIRT1995717	hsa-miR-802	CLIP-seq
MIRT1995710	hsa-miR-1236	CLIP-seq
MIRT997398	hsa-miR-3168	CLIP-seq
MIRT1995713	hsa-miR-338-5p	CLIP-seq
MIRT1995716	hsa-miR-4522	CLIP-seq
MIRT997416	hsa-miR-513a-3p	CLIP-seq
MIRT1995717	hsa-miR-802	CLIP-seq

Show/Hide all (7)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003723	Function	RNA binding	HDA	22658674
GO:0003755	Function	Peptidyl-prolyl cis-trans isomerase activity	IEA
GO:0005515	Function	Protein binding	IPI	19166840, 21812934
GO:0005528	Function	FK506 binding	TAS	1374240
GO:0005634	Component	Nucleus	IEA
GO:0016853	Function	Isomerase activity	IEA
GO:0038023	Function	Signaling receptor activity	TAS	1374240

MIM	HGNC	e!Ensembl
186947	3719	ENSG00000100442

Q00688

Protein name

Peptidyl-prolyl cis-trans isomerase FKBP3 (PPIase FKBP3) (EC 5.2.1.8) (25 kDa FK506-binding protein) (25 kDa FKBP) (FKBP-25) (FK506-binding protein 3) (FKBP-3) (Immunophilin FKBP25) (Rapamycin-selective 25 kDa immunophilin) (Rotamase)

Protein function

FK506- and rapamycin-binding proteins (FKBPs) constitute a family of receptors for the two immunosuppressants which inhibit T-cell proliferation by arresting two distinct cytoplasmic signal transmission pathways. PPIases accelerate the folding o

PDB

1PBK , 2KFV , 2MPH , 5D75 , 5GPG

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF18410	BTHB	6 → 77	Basic tilted helix bundle domain	Domain
PF00254	FKBP_C	121 → 221	FKBP-type peptidyl-prolyl cis-trans isomerase	Domain

Sequence

MAAAVPQRAWTVEQLRSEQLPKKDIIKFLQEHGSDSFLAEHKLLGNIKNVAKTANKDHLV
TAYNHLFETKRFKGTESISKVSEQVKNVKLNEDKPKETKSEETLDEGPPKYTKSVLKKGD
KTNFPKKGDVVHCWYTGTLQDGTVFDTNIQTSAKKKKNAKPLSFKVGVGKVIRGWDEALL
TMSKGEKARLEIEPEWAYGKKGQPDAKIPPNAKLTFEVELVDID

Sequence length

224

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
HYPERTENSIVE NEPHROPATHY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (10)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
AMYOTROPHIC LATERAL SCLEROSIS 1	Lateral Sclerosis	BEFREE	10077670		★★★★★ ★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	Pubtator	33491460	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	37082996	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	40179422	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	31524278		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	37082996	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	28839465		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoglophonic dwarfism	Osteoglosphonic dysplasia	BEFREE	29969783		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	31830361		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Diseases	Stomach Diseases	BEFREE	29148176		★★★★★ ★☆☆☆☆ Found in Text Mining only

FKBP3 (FKBP prolyl isomerase 3)