Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	22846
Gene name	Vasohibin 1
Gene symbol	VASH1
Synonyms (NCBI Gene)	KIAA1036TTCP 1
Chromosome	14
Chromosome location	14q24.3

240

Show/Hide all (240)

miRTarBase ID	miRNA	Experiments	Reference
MIRT017737	hsa-miR-335-5p	Microarray	18185580
MIRT650920	hsa-miR-5088-3p	HITS-CLIP	23824327
MIRT650919	hsa-miR-877-3p	HITS-CLIP	23824327
MIRT650918	hsa-miR-3667-3p	HITS-CLIP	23824327
MIRT650917	hsa-miR-152-5p	HITS-CLIP	23824327
MIRT650916	hsa-miR-623	HITS-CLIP	23824327
MIRT650915	hsa-miR-204-5p	HITS-CLIP	23824327
MIRT650914	hsa-miR-211-5p	HITS-CLIP	23824327
MIRT650913	hsa-miR-7111-3p	HITS-CLIP	23824327
MIRT650912	hsa-miR-6780a-3p	HITS-CLIP	23824327
MIRT650911	hsa-miR-6881-3p	HITS-CLIP	23824327
MIRT650910	hsa-miR-4727-5p	HITS-CLIP	23824327
MIRT650909	hsa-miR-5001-3p	HITS-CLIP	23824327
MIRT650908	hsa-miR-3977	HITS-CLIP	23824327
MIRT650906	hsa-miR-6738-3p	HITS-CLIP	23824327
MIRT650907	hsa-miR-6885-3p	HITS-CLIP	23824327
MIRT464292	hsa-miR-30c-5p	PAR-CLIP	23592263
MIRT464291	hsa-miR-30b-5p	PAR-CLIP	23592263
MIRT464290	hsa-miR-30a-5p	PAR-CLIP	23592263
MIRT464289	hsa-miR-30d-5p	PAR-CLIP	23592263
MIRT464288	hsa-miR-30e-5p	PAR-CLIP	23592263
MIRT464287	hsa-miR-4779	PAR-CLIP	23592263
MIRT464286	hsa-miR-4459	PAR-CLIP	23592263
MIRT464285	hsa-miR-665	PAR-CLIP	23592263
MIRT464284	hsa-miR-6840-3p	PAR-CLIP	23592263
MIRT464283	hsa-miR-1914-3p	PAR-CLIP	23592263
MIRT464282	hsa-miR-5194	PAR-CLIP	23592263
MIRT464281	hsa-miR-6738-5p	PAR-CLIP	23592263
MIRT464280	hsa-miR-765	PAR-CLIP	23592263
MIRT464279	hsa-miR-7106-5p	PAR-CLIP	23592263
MIRT464278	hsa-miR-4534	PAR-CLIP	23592263
MIRT733392	hsa-miR-143-3p	Luciferase reporter assayWestern blottingqRT-PCRIn situ hybridization	31823788
MIRT650920	hsa-miR-5088-3p	HITS-CLIP	23824327
MIRT650919	hsa-miR-877-3p	HITS-CLIP	23824327
MIRT650918	hsa-miR-3667-3p	HITS-CLIP	23824327
MIRT650917	hsa-miR-152-5p	HITS-CLIP	23824327
MIRT650916	hsa-miR-623	HITS-CLIP	23824327
MIRT650915	hsa-miR-204-5p	HITS-CLIP	23824327
MIRT650914	hsa-miR-211-5p	HITS-CLIP	23824327
MIRT650913	hsa-miR-7111-3p	HITS-CLIP	23824327
MIRT650912	hsa-miR-6780a-3p	HITS-CLIP	23824327
MIRT650911	hsa-miR-6881-3p	HITS-CLIP	23824327
MIRT650910	hsa-miR-4727-5p	HITS-CLIP	23824327
MIRT650909	hsa-miR-5001-3p	HITS-CLIP	23824327
MIRT650908	hsa-miR-3977	HITS-CLIP	23824327
MIRT650906	hsa-miR-6738-3p	HITS-CLIP	23824327
MIRT650907	hsa-miR-6885-3p	HITS-CLIP	23824327
MIRT464292	hsa-miR-30c-5p	PAR-CLIP	23592263
MIRT464291	hsa-miR-30b-5p	PAR-CLIP	23592263
MIRT464290	hsa-miR-30a-5p	PAR-CLIP	23592263
MIRT464289	hsa-miR-30d-5p	PAR-CLIP	23592263
MIRT464288	hsa-miR-30e-5p	PAR-CLIP	23592263
MIRT464287	hsa-miR-4779	PAR-CLIP	23592263
MIRT464286	hsa-miR-4459	PAR-CLIP	23592263
MIRT464285	hsa-miR-665	PAR-CLIP	23592263
MIRT464284	hsa-miR-6840-3p	PAR-CLIP	23592263
MIRT464283	hsa-miR-1914-3p	PAR-CLIP	23592263
MIRT464282	hsa-miR-5194	PAR-CLIP	23592263
MIRT464281	hsa-miR-6738-5p	PAR-CLIP	23592263
MIRT464280	hsa-miR-765	PAR-CLIP	23592263
MIRT464279	hsa-miR-7106-5p	PAR-CLIP	23592263
MIRT464278	hsa-miR-4534	PAR-CLIP	23592263
MIRT1482787	hsa-miR-1207-3p	CLIP-seq
MIRT1482788	hsa-miR-1238	CLIP-seq
MIRT1482789	hsa-miR-186	CLIP-seq
MIRT1482790	hsa-miR-200b	CLIP-seq
MIRT1482791	hsa-miR-200c	CLIP-seq
MIRT1482792	hsa-miR-3119	CLIP-seq
MIRT1482793	hsa-miR-3133	CLIP-seq
MIRT1482794	hsa-miR-3134	CLIP-seq
MIRT1482795	hsa-miR-3144-5p	CLIP-seq
MIRT1482796	hsa-miR-3176	CLIP-seq
MIRT1482797	hsa-miR-3183	CLIP-seq
MIRT1482798	hsa-miR-3191	CLIP-seq
MIRT1482799	hsa-miR-3199	CLIP-seq
MIRT1482800	hsa-miR-3202	CLIP-seq
MIRT1482801	hsa-miR-3714	CLIP-seq
MIRT1482802	hsa-miR-3922-3p	CLIP-seq
MIRT1482803	hsa-miR-429	CLIP-seq
MIRT1482804	hsa-miR-4475	CLIP-seq
MIRT1482805	hsa-miR-4505	CLIP-seq
MIRT1482806	hsa-miR-4513	CLIP-seq
MIRT1482807	hsa-miR-4533	CLIP-seq
MIRT1482808	hsa-miR-4650-5p	CLIP-seq
MIRT1482809	hsa-miR-4652-5p	CLIP-seq
MIRT1482810	hsa-miR-4667-5p	CLIP-seq
MIRT1482811	hsa-miR-4691-5p	CLIP-seq
MIRT1482812	hsa-miR-4700-5p	CLIP-seq
MIRT1482813	hsa-miR-4723-3p	CLIP-seq
MIRT1482814	hsa-miR-4726-3p	CLIP-seq
MIRT1482815	hsa-miR-4731-5p	CLIP-seq
MIRT1482816	hsa-miR-4740-5p	CLIP-seq
MIRT1482817	hsa-miR-4757-5p	CLIP-seq
MIRT1482818	hsa-miR-940	CLIP-seq
MIRT2145317	hsa-miR-1184	CLIP-seq
MIRT2145318	hsa-miR-1226	CLIP-seq
MIRT2145319	hsa-miR-1269	CLIP-seq
MIRT2145320	hsa-miR-1269b	CLIP-seq
MIRT2145321	hsa-miR-1291	CLIP-seq
MIRT2145322	hsa-miR-146b-3p	CLIP-seq
MIRT2145323	hsa-miR-1972	CLIP-seq
MIRT2145324	hsa-miR-2355-5p	CLIP-seq
MIRT2145325	hsa-miR-3157-5p	CLIP-seq
MIRT1482800	hsa-miR-3202	CLIP-seq
MIRT2145326	hsa-miR-3660	CLIP-seq
MIRT2145327	hsa-miR-3918	CLIP-seq
MIRT2145328	hsa-miR-4436b-3p	CLIP-seq
MIRT2145329	hsa-miR-4446-3p	CLIP-seq
MIRT2145330	hsa-miR-4487	CLIP-seq
MIRT2145331	hsa-miR-4514	CLIP-seq
MIRT2145332	hsa-miR-4526	CLIP-seq
MIRT2145333	hsa-miR-4530	CLIP-seq
MIRT2145334	hsa-miR-4685-5p	CLIP-seq
MIRT2145335	hsa-miR-4691-3p	CLIP-seq
MIRT2145336	hsa-miR-4692	CLIP-seq
MIRT2145337	hsa-miR-4722-3p	CLIP-seq
MIRT2145338	hsa-miR-4755-3p	CLIP-seq
MIRT2145339	hsa-miR-634	CLIP-seq
MIRT2145340	hsa-miR-670	CLIP-seq
MIRT2365568	hsa-miR-1273f	CLIP-seq
MIRT2365569	hsa-miR-143	CLIP-seq
MIRT2365570	hsa-miR-1913	CLIP-seq
MIRT2365571	hsa-miR-324-3p	CLIP-seq
MIRT2365572	hsa-miR-3655	CLIP-seq
MIRT2145329	hsa-miR-4446-3p	CLIP-seq
MIRT2365573	hsa-miR-4667-3p	CLIP-seq
MIRT2365574	hsa-miR-4708-5p	CLIP-seq
MIRT2365575	hsa-miR-4721	CLIP-seq
MIRT2145337	hsa-miR-4722-3p	CLIP-seq
MIRT2365576	hsa-miR-4770	CLIP-seq
MIRT2365577	hsa-miR-626	CLIP-seq
MIRT2145331	hsa-miR-4514	CLIP-seq
MIRT2145336	hsa-miR-4692	CLIP-seq
MIRT2145340	hsa-miR-670	CLIP-seq
MIRT2441620	hsa-miR-181a	CLIP-seq
MIRT2441621	hsa-miR-181b	CLIP-seq
MIRT2441622	hsa-miR-181c	CLIP-seq
MIRT2441623	hsa-miR-181d	CLIP-seq
MIRT2441624	hsa-miR-377	CLIP-seq
MIRT2441625	hsa-miR-4262	CLIP-seq
MIRT1482808	hsa-miR-4650-5p	CLIP-seq
MIRT1482817	hsa-miR-4757-5p	CLIP-seq
MIRT2441626	hsa-miR-668	CLIP-seq
MIRT2463135	hsa-miR-1224-3p	CLIP-seq
MIRT2463136	hsa-miR-129-5p	CLIP-seq
MIRT2463137	hsa-miR-2110	CLIP-seq
MIRT2463138	hsa-miR-3150a-3p	CLIP-seq
MIRT2463139	hsa-miR-3150b-3p	CLIP-seq
MIRT2145325	hsa-miR-3157-5p	CLIP-seq
MIRT2463140	hsa-miR-3166	CLIP-seq
MIRT2463141	hsa-miR-3175	CLIP-seq
MIRT2463142	hsa-miR-378g	CLIP-seq
MIRT2463143	hsa-miR-3943	CLIP-seq
MIRT2463144	hsa-miR-4257	CLIP-seq
MIRT2463145	hsa-miR-4260	CLIP-seq
MIRT2463146	hsa-miR-4284	CLIP-seq
MIRT2463147	hsa-miR-4292	CLIP-seq
MIRT2463148	hsa-miR-4308	CLIP-seq
MIRT2145328	hsa-miR-4436b-3p	CLIP-seq
MIRT2463149	hsa-miR-4437	CLIP-seq
MIRT2463150	hsa-miR-450b-5p	CLIP-seq
MIRT2145333	hsa-miR-4530	CLIP-seq
MIRT2365573	hsa-miR-4667-3p	CLIP-seq
MIRT2463151	hsa-miR-4674	CLIP-seq
MIRT2463152	hsa-miR-4689	CLIP-seq
MIRT2145335	hsa-miR-4691-3p	CLIP-seq
MIRT2463153	hsa-miR-4705	CLIP-seq
MIRT2145338	hsa-miR-4755-3p	CLIP-seq
MIRT2463154	hsa-miR-4784	CLIP-seq
MIRT2145340	hsa-miR-670	CLIP-seq
MIRT2463155	hsa-miR-939	CLIP-seq
MIRT1482787	hsa-miR-1207-3p	CLIP-seq
MIRT2659282	hsa-miR-1236	CLIP-seq
MIRT1482788	hsa-miR-1238	CLIP-seq
MIRT2441620	hsa-miR-181a	CLIP-seq
MIRT2441621	hsa-miR-181b	CLIP-seq
MIRT2441622	hsa-miR-181c	CLIP-seq
MIRT2441623	hsa-miR-181d	CLIP-seq
MIRT2659283	hsa-miR-192	CLIP-seq
MIRT2463137	hsa-miR-2110	CLIP-seq
MIRT2659284	hsa-miR-215	CLIP-seq
MIRT2659285	hsa-miR-2276	CLIP-seq
MIRT2463138	hsa-miR-3150a-3p	CLIP-seq
MIRT2463139	hsa-miR-3150b-3p	CLIP-seq
MIRT2463141	hsa-miR-3175	CLIP-seq
MIRT1482800	hsa-miR-3202	CLIP-seq
MIRT2659286	hsa-miR-3661	CLIP-seq
MIRT2441624	hsa-miR-377	CLIP-seq
MIRT2463145	hsa-miR-4260	CLIP-seq
MIRT2441625	hsa-miR-4262	CLIP-seq
MIRT2145329	hsa-miR-4446-3p	CLIP-seq
MIRT2659287	hsa-miR-4492	CLIP-seq
MIRT2659288	hsa-miR-4498	CLIP-seq
MIRT2463150	hsa-miR-450b-5p	CLIP-seq
MIRT2659289	hsa-miR-4646-5p	CLIP-seq
MIRT1482808	hsa-miR-4650-5p	CLIP-seq
MIRT2463152	hsa-miR-4689	CLIP-seq
MIRT1482811	hsa-miR-4691-5p	CLIP-seq
MIRT2463153	hsa-miR-4705	CLIP-seq
MIRT2659290	hsa-miR-4708-3p	CLIP-seq
MIRT2659291	hsa-miR-4747-5p	CLIP-seq
MIRT2145338	hsa-miR-4755-3p	CLIP-seq
MIRT1482817	hsa-miR-4757-5p	CLIP-seq
MIRT2659292	hsa-miR-4761-5p	CLIP-seq
MIRT2659293	hsa-miR-4778-3p	CLIP-seq
MIRT2463154	hsa-miR-4784	CLIP-seq
MIRT2659294	hsa-miR-4792	CLIP-seq
MIRT2659295	hsa-miR-631	CLIP-seq
MIRT2659296	hsa-miR-762	CLIP-seq
MIRT2463155	hsa-miR-939	CLIP-seq
MIRT1482787	hsa-miR-1207-3p	CLIP-seq
MIRT1482788	hsa-miR-1238	CLIP-seq
MIRT2694897	hsa-miR-1262	CLIP-seq
MIRT2659283	hsa-miR-192	CLIP-seq
MIRT2694898	hsa-miR-204	CLIP-seq
MIRT2694899	hsa-miR-211	CLIP-seq
MIRT2659284	hsa-miR-215	CLIP-seq
MIRT2659285	hsa-miR-2276	CLIP-seq
MIRT2694900	hsa-miR-3184	CLIP-seq
MIRT2694901	hsa-miR-324-5p	CLIP-seq
MIRT2694902	hsa-miR-3622b-5p	CLIP-seq
MIRT2659286	hsa-miR-3661	CLIP-seq
MIRT2694903	hsa-miR-3910	CLIP-seq
MIRT2694904	hsa-miR-423-5p	CLIP-seq
MIRT2463147	hsa-miR-4292	CLIP-seq
MIRT2694905	hsa-miR-4297	CLIP-seq
MIRT2463148	hsa-miR-4308	CLIP-seq
MIRT2694906	hsa-miR-4639-3p	CLIP-seq
MIRT2659289	hsa-miR-4646-5p	CLIP-seq
MIRT1482811	hsa-miR-4691-5p	CLIP-seq
MIRT2694907	hsa-miR-4701-3p	CLIP-seq
MIRT2659290	hsa-miR-4708-3p	CLIP-seq
MIRT2694908	hsa-miR-4710	CLIP-seq
MIRT2694909	hsa-miR-4720-5p	CLIP-seq
MIRT2659291	hsa-miR-4747-5p	CLIP-seq
MIRT2694910	hsa-miR-4755-5p	CLIP-seq
MIRT2694911	hsa-miR-4799-3p	CLIP-seq
MIRT2694912	hsa-miR-545	CLIP-seq
MIRT2694913	hsa-miR-548an	CLIP-seq
MIRT2659295	hsa-miR-631	CLIP-seq

Show/Hide all (34)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001525	Process	Angiogenesis	IDA	15467828
GO:0001937	Process	Negative regulation of endothelial cell proliferation	IDA	19204325
GO:0001937	Process	Negative regulation of endothelial cell proliferation	IDA	15467828
GO:0003779	Function	Actin binding	IDA	29146869
GO:0003779	Function	Actin binding	IEA
GO:0004180	Function	Carboxypeptidase activity	IEA
GO:0004181	Function	Metallocarboxypeptidase activity	IDA	29146869
GO:0004181	Function	Metallocarboxypeptidase activity	IEA
GO:0004181	Function	Metallocarboxypeptidase activity	IMP	31171830, 31235911
GO:0005515	Function	Protein binding	IPI	25416956, 29146869, 31171830, 31235910, 31270470
GO:0005576	Component	Extracellular region	IEA
GO:0005615	Component	Extracellular space	IDA	15467828, 20133819, 20736312
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	15467828
GO:0005737	Component	Cytoplasm	IEA
GO:0005783	Component	Endoplasmic reticulum	IDA	15467828
GO:0006508	Process	Proteolysis	IDA	29146869
GO:0006508	Process	Proteolysis	IEA
GO:0008233	Function	Peptidase activity	IEA
GO:0009611	Process	Response to wounding	IDA	23056314
GO:0016525	Process	Negative regulation of angiogenesis	IDA	15467828
GO:0016525	Process	Negative regulation of angiogenesis	IEA
GO:0016525	Process	Negative regulation of angiogenesis	IGI	20133819
GO:0016787	Function	Hydrolase activity	IEA
GO:0043537	Process	Negative regulation of blood vessel endothelial cell migration	IDA	15467828
GO:0045177	Component	Apical part of cell	IDA	20736312
GO:0045765	Process	Regulation of angiogenesis	IBA
GO:0045765	Process	Regulation of angiogenesis	IEA
GO:0051726	Process	Regulation of cell cycle	IEA
GO:0060674	Process	Placenta blood vessel development	IEA
GO:0060716	Process	Labyrinthine layer blood vessel development	IEA
GO:0106423	Function	Tubulin-tyrosine carboxypeptidase	IEA
GO:1901491	Process	Negative regulation of lymphangiogenesis	IGI	20133819
GO:2000772	Process	Regulation of cellular senescence	IMP	23056314

MIM	HGNC	e!Ensembl
609011	19964	ENSG00000071246

Q7L8A9

Protein name

Tubulinyl-Tyr carboxypeptidase 1 (EC 3.4.17.17) (Tubulin carboxypeptidase 1) (Tyrosine carboxypeptidase 1) (TTCP 1) (Vasohibin-1)

Protein function

Tyrosine carboxypeptidase that removes the C-terminal tyrosine residue of alpha-tubulin, thereby regulating microtubule dynamics and function (PubMed:29146869, PubMed:31171830, PubMed:31235910, PubMed:31235911, PubMed:31270470). Critical for spi

PDB

6J4U , 6J7B , 6J8F , 6J8N , 6J8O , 6J91 , 6J9H , 6K81 , 6LPG , 6NVQ , 6OCF , 6OCG , 6OCH , 6WSL

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF14822	Vasohibin	58 → 302	Vasohibin	Domain

Tissue specificity

TISSUE SPECIFICITY: Preferentially expressed in endothelial cells (PubMed:15467828, PubMed:16707096). Highly expressed in fetal organs (PubMed:15467828). Expressed in brain and placenta, and at lower level in heart and kidney (PubMed:15467828). Highly det

Sequence

MPGGKKVAGGGSSGATPTSAAATAPSGVRRLETSEGTSAQRDEEPEEEGEEDLRDGGVPF
FVNRGGLPVDEATWERMWKHVAKIHPDGEKVAQRIRGATDLPKIPIPSVPTFQPSTPVPE
RLEAVQRYIRELQYNHTGTQFFEIKKSRPLTGLMDLAKEMTKEALPIKCLEAVILGIYLT
NSMPTLERFPISFKTYFSGNYFRHIVLGVNFAGRYGALGMSRREDLMYKPPAFRTLSELV
LDFEAAYGRCWHVLKKVKLGQSVSHDPHSVEQIEWKHSVLDVERLGRDDFRKELERHARD
MRLKIGKGTGPPSPTKDRKKDVSSPQRAQSSPHRRNSRSERRPSGDKKTSEPKAMPDLNG
YQIRV

Sequence length

365

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
LIVER CIRRHOSIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PORTAL HYPERTENSION	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (68)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	29552154		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	Pubtator	25843115	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	20035291	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	29042936		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	28693142		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal	Ductal carcinoma	Pubtator	20704578	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal Breast	Ductal carcinoma of breast	Pubtator	20704578	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Intraductal Noninfiltrating	Intraductal noninfiltrating carcinoma	Pubtator	20704578	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	29042936		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	29552154, 31823788		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	38010374	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	28287633	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	26893100, 29057763		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	20704578		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carotid Atherosclerosis	Carotid Atherosclerosis	BEFREE	25843115		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carotid Stenosis	Carotid artery stenosis	Pubtator	25843115	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	25843115	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	29759640	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	29937525		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	24390792		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	25797264		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	24366689, 25275025		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	37426316	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	28287633, 28656230		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	24558106		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	31097304		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	31097304		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	21228103, 31097304		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	21228103, 31097304		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	29067450		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hirschsprung Disease	Hirschsprung disease	Pubtator	29483666	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholangiocarcinoma	Intrahepatic Cholangiocarcinoma	BEFREE	29759640		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	25843115		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	29937525		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	31091125		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	31757187		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	24390792		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lymphatic Metastasis	Lymphatic Metastasis	BEFREE	30254211		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	29552154, 31823788		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	26893100, 29057763		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	23651239		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	29535800, 31712637		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	26666821		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	29042936		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	24066086, 25797264, 27879017, 29042936, 29057763, 29535800		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	25797264		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	19037993		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	19682397		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mouth Diseases	Mouth disease	Pubtator	25145408	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	19498005, 19799859, 20704578, 23651239, 24066086, 24366689, 25275025, 25395319, 25797264, 26666821, 26893100, 28032401, 28287633, 28314285, 28656230, 29042936, 29067450 View all (2 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Noninfiltrating Intraductal Carcinoma	Ductal carcinoma	BEFREE	20704578		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	21228103		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	29556314		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Carcinoma	Ovarian Carcinoma	BEFREE	29057763		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	26893100		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	29057763, 38010374, 39710372	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	23651239		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	23651239	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Periodontal disease	Pubtator	36566872	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	36566872	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	36566872	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Portal Hypertension	Portal Hypertension	BEFREE	24390792		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostate carcinoma	Prostate cancer	BEFREE	29535800, 31712637		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	23591203	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	28656230		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	30250596		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	28314285		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	27325558		★★★★★ ★☆☆☆☆ Found in Text Mining only

VASH1 (vasohibin 1)