RNF44 (ring finger protein 44)

Gene Gene information from NCBI Gene database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID 22838
Gene name Ring finger protein 44
Gene symbol RNF44
Synonyms (NCBI Gene)
-
Chromosome 5
Chromosome location 5q35.2
Summary The protein encoded by this gene contains a RING finger, a motif present in a variety of functionally distinct proteins and known to be involved in protein-protein and protein-DNA interactions. [provided by RefSeq, Jul 2008]
miRNA miRNA information provided by mirtarbase database.
834
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all (834)
miRTarBase ID miRNA Experiments Reference
MIRT019199 hsa-miR-335-5p Microarray 18185580
MIRT021481 hsa-miR-9-5p Sequencing 20371350
MIRT024187 hsa-miR-221-3p Sequencing 20371350
MIRT027333 hsa-miR-101-3p Sequencing 20371350
MIRT027854 hsa-miR-98-5p Microarray 19088304
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
5
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all (5)
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 32296183
GO:0008270 Function Zinc ion binding IEA
GO:0016567 Process Protein ubiquitination IBA
GO:0046872 Function Metal ion binding IEA
GO:0061630 Function Ubiquitin protein ligase activity IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
619283 19180 ENSG00000146083
Protein Protein information from UniProt database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q7L0R7
Protein name RING finger protein 44
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13639 zf-RING_2 378 → 421 Ring finger domain Domain
Sequence 
MRPWALAVTRWPPSAPVGQRRFSAGPGSTPGQLWGSPGLEGPLASPPARDERLPSQQPPS
RPPHLPVEERRASAPAGGSPRMLHPATQQSPFMVDLHEQVHQGPVPLSYTVTTVTTQGFP
LPTGQHIPGCSAQQLPACSVMFSGQHYPLCCLPPPLIQACTMQQLPVPYQAYPHLISSDH
YILHPPPPAPPPQPTHMAPLGQFVSLQTQHPRMPLQRLDNDVDLRGDQPSLGSFTYSTSA
PGPALSPSVPLHYLPHDPLHQELSFGVPYSHMMPRRLSTQRYRLQQPLPPPPPPPPPPPY
YPSFLPYFLSMLPMSPTAMGPTISLDLDVDDVEMENYEALLNLAERLGDAKPRGLTKADI
EQLPSYRFNPDSHQSEQTLCVVCFSDFEARQLLRVLPCNHEFHTKCVDKWLKANRTCPIC
RADASEVPREAE
Sequence length 432
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
1
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Show/Hide Unknown Diseases (1)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
VENOUS THROMBOEMBOLISM — GWAS catalog
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Show/Hide Text Mining Associations (5)
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Carcinoma Hepatocellular Hepatocellular carcinoma Pubtator 35494516 Stimulate
★★★★★
★☆☆☆☆
Found in Text Mining only
melanoma Melanoma BEFREE 29094484
★★★★★
★☆☆☆☆
Found in Text Mining only
Melanoma Melanoma Pubtator 35494516 Associate
★★★★★
★☆☆☆☆
Found in Text Mining only
Neoplasms Neoplasms BEFREE 29094484
★★★★★
★☆☆☆☆
Found in Text Mining only
Osteoarthritis Osteoarthritis Pubtator 33468167 Associate
★★★★★
★☆☆☆☆
Found in Text Mining only