Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	22829
Gene name	Neuroligin 4 Y-linked
Gene symbol	NLGN4Y
Synonyms (NCBI Gene)	HNL4Y
Chromosome	Y
Chromosome location	Yq11.221
Summary	This gene encodes a type I membrane protein that belongs to the family of neuroligins, which are cell adhesion molecules present at the postsynaptic side of the synapse, and may be essential for the formation of functional synapses. Alternatively spliced

Show/Hide all (58)

miRTarBase ID	miRNA	Experiments	Reference
MIRT018830	hsa-miR-335-5p	Microarray	18185580
MIRT023037	hsa-miR-124-3p	Microarray	18668037
MIRT1186810	hsa-miR-1290	CLIP-seq
MIRT1186811	hsa-miR-1324	CLIP-seq
MIRT1186812	hsa-miR-23a	CLIP-seq
MIRT1186813	hsa-miR-23b	CLIP-seq
MIRT1186814	hsa-miR-23c	CLIP-seq
MIRT1186815	hsa-miR-3143	CLIP-seq
MIRT1186816	hsa-miR-3167	CLIP-seq
MIRT1186817	hsa-miR-330-3p	CLIP-seq
MIRT1186818	hsa-miR-3653	CLIP-seq
MIRT1186819	hsa-miR-3658	CLIP-seq
MIRT1186820	hsa-miR-3942-3p	CLIP-seq
MIRT1186821	hsa-miR-412	CLIP-seq
MIRT1186822	hsa-miR-4307	CLIP-seq
MIRT1186823	hsa-miR-4422	CLIP-seq
MIRT1186824	hsa-miR-4659a-3p	CLIP-seq
MIRT1186825	hsa-miR-4659b-3p	CLIP-seq
MIRT1186826	hsa-miR-4777-5p	CLIP-seq
MIRT1186827	hsa-miR-5096	CLIP-seq
MIRT1186828	hsa-miR-518d-5p	CLIP-seq
MIRT1186829	hsa-miR-519b-5p	CLIP-seq
MIRT1186830	hsa-miR-519c-5p	CLIP-seq
MIRT1186831	hsa-miR-520c-5p	CLIP-seq
MIRT1186832	hsa-miR-520d-5p	CLIP-seq
MIRT1186833	hsa-miR-524-5p	CLIP-seq
MIRT1186834	hsa-miR-526a	CLIP-seq
MIRT1186835	hsa-miR-543	CLIP-seq
MIRT1186836	hsa-miR-876-5p	CLIP-seq
MIRT1186837	hsa-miR-924	CLIP-seq
MIRT1186838	hsa-miR-2467-3p	CLIP-seq
MIRT1186839	hsa-miR-3660	CLIP-seq
MIRT1186840	hsa-miR-4266	CLIP-seq
MIRT1186841	hsa-miR-4270	CLIP-seq
MIRT1186842	hsa-miR-4441	CLIP-seq
MIRT1186843	hsa-miR-4526	CLIP-seq
MIRT1186844	hsa-miR-4695-5p	CLIP-seq
MIRT1186845	hsa-miR-4717-5p	CLIP-seq
MIRT1186846	hsa-miR-4779	CLIP-seq
MIRT1186847	hsa-miR-486-3p	CLIP-seq
MIRT1186848	hsa-miR-539	CLIP-seq
MIRT1186811	hsa-miR-1324	CLIP-seq
MIRT1186820	hsa-miR-3942-3p	CLIP-seq
MIRT1186822	hsa-miR-4307	CLIP-seq
MIRT1186811	hsa-miR-1324	CLIP-seq
MIRT2054129	hsa-miR-3145-3p	CLIP-seq
MIRT1186820	hsa-miR-3942-3p	CLIP-seq
MIRT1186822	hsa-miR-4307	CLIP-seq
MIRT2054130	hsa-miR-548n	CLIP-seq
MIRT2054131	hsa-miR-548t	CLIP-seq
MIRT2054132	hsa-miR-570	CLIP-seq
MIRT2054133	hsa-miR-607	CLIP-seq
MIRT2455242	hsa-miR-31	CLIP-seq
MIRT2455243	hsa-miR-4511	CLIP-seq
MIRT2455244	hsa-miR-4700-3p	CLIP-seq
MIRT2455245	hsa-miR-4773	CLIP-seq
MIRT2455246	hsa-miR-643	CLIP-seq
MIRT2686401	hsa-miR-548p	CLIP-seq

Show/Hide all (22)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	17292328
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0007155	Process	Cell adhesion	IEA
GO:0007158	Process	Neuron cell-cell adhesion	TAS	18923512
GO:0007612	Process	Learning	IMP	18628683
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	TAS	21838267
GO:0035176	Process	Social behavior	IMP	18628683
GO:0042043	Function	Neurexin family protein binding	IEA
GO:0045202	Component	Synapse	IEA
GO:0045211	Component	Postsynaptic membrane	IEA
GO:0050839	Function	Cell adhesion molecule binding	TAS	18923512
GO:0071625	Process	Vocalization behavior	IMP	18628683
GO:0097110	Function	Scaffold protein binding	IPI	17292328
GO:0098839	Component	Postsynaptic density membrane	IEA
GO:0098983	Component	Symmetric, GABA-ergic, inhibitory synapse	TAS	21838267
GO:0098984	Component	Neuron to neuron synapse	IEA
GO:0098985	Component	Asymmetric, glutamatergic, excitatory synapse	TAS	21838267
GO:0099054	Process	Presynapse assembly	IEA
GO:0099054	Process	Presynapse assembly	TAS	21838267
GO:0099634	Component	Postsynaptic specialization membrane	IBA

MIM	HGNC	e!Ensembl
400028	15529	ENSG00000165246

Q8NFZ3

Protein name

Neuroligin-4, Y-linked (Neuroligin Y)

Protein function

Cell surface protein involved in cell-cell-interactions via its interactions with neurexin family members.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00135	COesterase	44 → 590	Carboxylesterase family	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in fetal and adult brain, prostate and testis. {ECO:0000269|PubMed:12815422}.

Sequence

MLRPQGLLWLPLLFTSVCVMLNSNVLLWITALAIKFTLIDSQAQYPVVNTNYGKIQGLRT
PLPSEILGPVEQYLGVPYASPPTGERRFQPPESPSSWTGIRNATQFSAVCPQHLDERFLL
HDMLPIWFTTSLDTLMTYVQDQNEDCLYLNIYVPMEDDIHEQNSKKPVMVYIHGGSYMEG
TGNMIDGSILASYGNVIVITINYRLGILGFLSTGDQAAKGNYGLLDQIQALRWIEENVGA
FGGDPKRVTIFGSGAGASCVSLLTLSHYSEGLFQKAIIQSGTALSSWAVNYQPAKYTRIL
ADKVGCNMLDTTDMVECLKNKNYKELIQQTITPATYHIAFGPVIDGDVIPDDPQILMEQG
EFLNYDIMLGVNQGEGLKFVDGIVDNEDGVTPNDFDFSVSNFVDNLYGYPEGKDTLRETI
KFMYTDWADKENPETRRKTLVALFTDHQWVAPAVATADLHAQYGSPTYFYAFYHHCQSEM
KPSWADSAHGDEVPYVFGIPMIGPTELFSCNFSKNDVMLSAVVMTYWTNFAKTGDPNQPV
PQDTKFIHTKPNRFEEVAWSKYNPKDQLYLHIGLKPRVRDHYRATKVAFWLELVPHLHNL
NEIFQYVSTTTKVPPPDMTSFPYGTRRSPAKIWPTTKRPAITPANNPKHSKDPHKTGPED
TTVLIETKRDYSTELSVTIAVGASLLFLNILAFAALYYKKDKRRHETHRHPSPQRNTTND
ITHIQNEEIMSLQMKQLEHDHECESLQAHDTLRLTCPPDYTLTLRRSPDDIPFMTPNTIT
MIPNTLMGMQPLHTFKTFSGGQNSTNLPHGHSTTRV

Sequence length

816

Interactions

View interactions

	KEGG		Reactome
	Cell adhesion molecules		Neurexins and neuroligins

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
MALE INFERTILITY WITH AZOOSPERMIA OR OLIGOZOOSPERMIA DUE TO SINGLE GENE MUTATION	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (18)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Anxiety	Anxiety Disorder	BEFREE	25558953		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety disorder	Pubtator	25558953	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	25558953		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorder	Autism	Pubtator	25558953, 32243781	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autistic behavior	Autism	BEFREE	25558953		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	BEFREE	16077734, 18628683, 25558953, 31161682		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	LHGDN	16077734, 18628683		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	Pubtator	25558953, 31852540, 32243781, 33832486	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	25558953		★★★★★ ★☆☆☆☆ Found in Text Mining only
Disorders of Sex Development	Disorders of sex development	Pubtator	33832486	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Graft vs Host Disease	Graft-versus-host disease	Pubtator	30262602	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	BEFREE	18628683		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	LHGDN	18628683		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	27626693		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	25558953		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Retardation	Mental retardation	BEFREE	18628683		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	27626693		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	27626693	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only

NLGN4Y (neuroligin 4 Y-linked)