Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Associated diseases
Entrez ID	22809
Gene name	Activating transcription factor 5
Gene symbol	ATF5
Synonyms (NCBI Gene)	ATFXHMFN0395
Chromosome	19
Chromosome location	19q13.33

182

Show/Hide all (182)

miRTarBase ID	miRNA	Experiments	Reference
MIRT025724	hsa-miR-7-5p	Microarray	19073608
MIRT046831	hsa-miR-222-3p	CLASH	23622248
MIRT716538	hsa-miR-6856-3p	HITS-CLIP	19536157
MIRT716537	hsa-miR-6769a-3p	HITS-CLIP	19536157
MIRT716536	hsa-miR-6892-3p	HITS-CLIP	19536157
MIRT716535	hsa-miR-519d-5p	HITS-CLIP	19536157
MIRT716534	hsa-miR-5695	HITS-CLIP	19536157
MIRT716533	hsa-miR-4749-3p	HITS-CLIP	19536157
MIRT716532	hsa-miR-515-5p	HITS-CLIP	19536157
MIRT716531	hsa-miR-519e-5p	HITS-CLIP	19536157
MIRT151995	hsa-miR-142-3p	HITS-CLIP	22473208
MIRT151995	hsa-miR-142-3p	HITS-CLIP	22473208
MIRT735195	hsa-miR-520b	Luciferase reporter assayqRT-PCR	32603335
MIRT716538	hsa-miR-6856-3p	HITS-CLIP	19536157
MIRT716537	hsa-miR-6769a-3p	HITS-CLIP	19536157
MIRT716536	hsa-miR-6892-3p	HITS-CLIP	19536157
MIRT716535	hsa-miR-519d-5p	HITS-CLIP	19536157
MIRT716534	hsa-miR-5695	HITS-CLIP	19536157
MIRT716533	hsa-miR-4749-3p	HITS-CLIP	19536157
MIRT716532	hsa-miR-515-5p	HITS-CLIP	19536157
MIRT716531	hsa-miR-519e-5p	HITS-CLIP	19536157
MIRT804283	hsa-miR-106a	CLIP-seq
MIRT804284	hsa-miR-106b	CLIP-seq
MIRT804285	hsa-miR-1182	CLIP-seq
MIRT804286	hsa-miR-1185	CLIP-seq
MIRT804287	hsa-miR-1250	CLIP-seq
MIRT804288	hsa-miR-141	CLIP-seq
MIRT804289	hsa-miR-150	CLIP-seq
MIRT804290	hsa-miR-17	CLIP-seq
MIRT804291	hsa-miR-1912	CLIP-seq
MIRT804292	hsa-miR-192	CLIP-seq
MIRT804293	hsa-miR-193a-5p	CLIP-seq
MIRT804294	hsa-miR-1976	CLIP-seq
MIRT804295	hsa-miR-200a	CLIP-seq
MIRT804296	hsa-miR-20a	CLIP-seq
MIRT804297	hsa-miR-20b	CLIP-seq
MIRT804298	hsa-miR-2115	CLIP-seq
MIRT804299	hsa-miR-215	CLIP-seq
MIRT804300	hsa-miR-2861	CLIP-seq
MIRT804301	hsa-miR-302a	CLIP-seq
MIRT804302	hsa-miR-302b	CLIP-seq
MIRT804303	hsa-miR-302c	CLIP-seq
MIRT804304	hsa-miR-302d	CLIP-seq
MIRT804305	hsa-miR-302e	CLIP-seq
MIRT804306	hsa-miR-3130-3p	CLIP-seq
MIRT804307	hsa-miR-3150a-5p	CLIP-seq
MIRT804308	hsa-miR-3150b-5p	CLIP-seq
MIRT804309	hsa-miR-3161	CLIP-seq
MIRT804310	hsa-miR-3173-3p	CLIP-seq
MIRT804311	hsa-miR-339-5p	CLIP-seq
MIRT804312	hsa-miR-3613-3p	CLIP-seq
MIRT804313	hsa-miR-3673	CLIP-seq
MIRT804314	hsa-miR-3679-5p	CLIP-seq
MIRT804315	hsa-miR-372	CLIP-seq
MIRT804316	hsa-miR-373	CLIP-seq
MIRT804317	hsa-miR-3945	CLIP-seq
MIRT804318	hsa-miR-3976	CLIP-seq
MIRT804319	hsa-miR-4252	CLIP-seq
MIRT804320	hsa-miR-4258	CLIP-seq
MIRT804321	hsa-miR-4265	CLIP-seq
MIRT804322	hsa-miR-4296	CLIP-seq
MIRT804323	hsa-miR-4312	CLIP-seq
MIRT804324	hsa-miR-4322	CLIP-seq
MIRT804325	hsa-miR-4417	CLIP-seq
MIRT804326	hsa-miR-4423-5p	CLIP-seq
MIRT804327	hsa-miR-4428	CLIP-seq
MIRT804328	hsa-miR-4501	CLIP-seq
MIRT804329	hsa-miR-4533	CLIP-seq
MIRT804330	hsa-miR-4638-5p	CLIP-seq
MIRT804331	hsa-miR-4683	CLIP-seq
MIRT804332	hsa-miR-4687-3p	CLIP-seq
MIRT804333	hsa-miR-4722-3p	CLIP-seq
MIRT804334	hsa-miR-4731-5p	CLIP-seq
MIRT804335	hsa-miR-4747-5p	CLIP-seq
MIRT804336	hsa-miR-4757-5p	CLIP-seq
MIRT804337	hsa-miR-4774-5p	CLIP-seq
MIRT804338	hsa-miR-4779	CLIP-seq
MIRT804339	hsa-miR-4781-3p	CLIP-seq
MIRT804340	hsa-miR-512-3p	CLIP-seq
MIRT804341	hsa-miR-516a-3p	CLIP-seq
MIRT804342	hsa-miR-519d	CLIP-seq
MIRT804343	hsa-miR-520a-3p	CLIP-seq
MIRT804344	hsa-miR-520c-3p	CLIP-seq
MIRT804345	hsa-miR-520d-3p	CLIP-seq
MIRT804346	hsa-miR-520e	CLIP-seq
MIRT804347	hsa-miR-520g	CLIP-seq
MIRT804348	hsa-miR-520h	CLIP-seq
MIRT804349	hsa-miR-548c-3p	CLIP-seq
MIRT804350	hsa-miR-550b	CLIP-seq
MIRT804351	hsa-miR-610	CLIP-seq
MIRT804352	hsa-miR-633	CLIP-seq
MIRT804353	hsa-miR-670	CLIP-seq
MIRT804354	hsa-miR-93	CLIP-seq
MIRT804355	hsa-miR-941	CLIP-seq
MIRT804356	hsa-miR-1178	CLIP-seq
MIRT804357	hsa-miR-129-5p	CLIP-seq
MIRT804288	hsa-miR-141	CLIP-seq
MIRT804289	hsa-miR-150	CLIP-seq
MIRT804295	hsa-miR-200a	CLIP-seq
MIRT804358	hsa-miR-3130-5p	CLIP-seq
MIRT804307	hsa-miR-3150a-5p	CLIP-seq
MIRT804308	hsa-miR-3150b-5p	CLIP-seq
MIRT804310	hsa-miR-3173-3p	CLIP-seq
MIRT804312	hsa-miR-3613-3p	CLIP-seq
MIRT804359	hsa-miR-3646	CLIP-seq
MIRT804360	hsa-miR-3662	CLIP-seq
MIRT804320	hsa-miR-4258	CLIP-seq
MIRT804361	hsa-miR-433	CLIP-seq
MIRT804362	hsa-miR-4482	CLIP-seq
MIRT804363	hsa-miR-4520b-3p	CLIP-seq
MIRT804364	hsa-miR-4529-3p	CLIP-seq
MIRT804365	hsa-miR-4704-3p	CLIP-seq
MIRT804366	hsa-miR-4804-5p	CLIP-seq
MIRT804349	hsa-miR-548c-3p	CLIP-seq
MIRT804351	hsa-miR-610	CLIP-seq
MIRT804283	hsa-miR-106a	CLIP-seq
MIRT804284	hsa-miR-106b	CLIP-seq
MIRT804289	hsa-miR-150	CLIP-seq
MIRT804290	hsa-miR-17	CLIP-seq
MIRT804294	hsa-miR-1976	CLIP-seq
MIRT804296	hsa-miR-20a	CLIP-seq
MIRT804297	hsa-miR-20b	CLIP-seq
MIRT804301	hsa-miR-302a	CLIP-seq
MIRT804302	hsa-miR-302b	CLIP-seq
MIRT804303	hsa-miR-302c	CLIP-seq
MIRT804304	hsa-miR-302d	CLIP-seq
MIRT804305	hsa-miR-302e	CLIP-seq
MIRT804309	hsa-miR-3161	CLIP-seq
MIRT804310	hsa-miR-3173-3p	CLIP-seq
MIRT1937526	hsa-miR-3176	CLIP-seq
MIRT1937527	hsa-miR-371-5p	CLIP-seq
MIRT804315	hsa-miR-372	CLIP-seq
MIRT804316	hsa-miR-373	CLIP-seq
MIRT1937528	hsa-miR-3922-3p	CLIP-seq
MIRT804323	hsa-miR-4312	CLIP-seq
MIRT804361	hsa-miR-433	CLIP-seq
MIRT804327	hsa-miR-4428	CLIP-seq
MIRT804363	hsa-miR-4520b-3p	CLIP-seq
MIRT804364	hsa-miR-4529-3p	CLIP-seq
MIRT804329	hsa-miR-4533	CLIP-seq
MIRT804331	hsa-miR-4683	CLIP-seq
MIRT804333	hsa-miR-4722-3p	CLIP-seq
MIRT804334	hsa-miR-4731-5p	CLIP-seq
MIRT804335	hsa-miR-4747-5p	CLIP-seq
MIRT804336	hsa-miR-4757-5p	CLIP-seq
MIRT804338	hsa-miR-4779	CLIP-seq
MIRT804366	hsa-miR-4804-5p	CLIP-seq
MIRT804340	hsa-miR-512-3p	CLIP-seq
MIRT804342	hsa-miR-519d	CLIP-seq
MIRT804343	hsa-miR-520a-3p	CLIP-seq
MIRT804344	hsa-miR-520c-3p	CLIP-seq
MIRT804345	hsa-miR-520d-3p	CLIP-seq
MIRT804346	hsa-miR-520e	CLIP-seq
MIRT804347	hsa-miR-520g	CLIP-seq
MIRT804348	hsa-miR-520h	CLIP-seq
MIRT804354	hsa-miR-93	CLIP-seq
MIRT2177154	hsa-miR-1207-5p	CLIP-seq
MIRT2177155	hsa-miR-1827	CLIP-seq
MIRT2177156	hsa-miR-1909	CLIP-seq
MIRT804292	hsa-miR-192	CLIP-seq
MIRT804294	hsa-miR-1976	CLIP-seq
MIRT804299	hsa-miR-215	CLIP-seq
MIRT804306	hsa-miR-3130-3p	CLIP-seq
MIRT1937527	hsa-miR-371-5p	CLIP-seq
MIRT2177157	hsa-miR-3927	CLIP-seq
MIRT804319	hsa-miR-4252	CLIP-seq
MIRT804361	hsa-miR-433	CLIP-seq
MIRT2177158	hsa-miR-4421	CLIP-seq
MIRT804327	hsa-miR-4428	CLIP-seq
MIRT2177159	hsa-miR-4451	CLIP-seq
MIRT2177160	hsa-miR-4493	CLIP-seq
MIRT2177161	hsa-miR-4525	CLIP-seq
MIRT804331	hsa-miR-4683	CLIP-seq
MIRT2177162	hsa-miR-4716-3p	CLIP-seq
MIRT804333	hsa-miR-4722-3p	CLIP-seq
MIRT804336	hsa-miR-4757-5p	CLIP-seq
MIRT2177163	hsa-miR-4763-3p	CLIP-seq
MIRT2177164	hsa-miR-493	CLIP-seq
MIRT2177165	hsa-miR-524-3p	CLIP-seq
MIRT2177166	hsa-miR-525-3p	CLIP-seq
MIRT2177167	hsa-miR-940	CLIP-seq
MIRT804355	hsa-miR-941	CLIP-seq

Show/Hide all (3)

Transcription factor	Regulation	Reference
DDIT3	Repression	16164412
EBF1	Unknown	20423929
NPM1	Repression	22528486

Show/Hide all (58)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	ISA
GO:0000976	Function	Transcription cis-regulatory region binding	IEA
GO:0000976	Function	Transcription cis-regulatory region binding	ISS
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IBA
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IMP	15890932
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IBA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IDA	16300731
GO:0003677	Function	DNA binding	IEA
GO:0003682	Function	Chromatin binding	IDA	21212266
GO:0003682	Function	Chromatin binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IDA	20654631
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0003700	Function	DNA-binding transcription factor activity	ISS
GO:0005515	Function	Protein binding	IPI	10373550, 12812986, 20102225, 20211142, 22528486, 23661758, 26213385, 32296183
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	22528486
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	NAS	20102225, 23661758
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005667	Component	Transcription regulator complex	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005813	Component	Centrosome	IDA	26213385
GO:0005813	Component	Centrosome	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005856	Component	Cytoskeleton	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IDA	20654631
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	NAS	20102225, 23661758
GO:0007623	Process	Circadian rhythm	IEA
GO:0008285	Process	Negative regulation of cell population proliferation	IDA	22528486
GO:0009791	Process	Post-embryonic development	IEA
GO:0010468	Process	Regulation of gene expression	IEA
GO:0015631	Function	Tubulin binding	IDA	26213385
GO:0019900	Function	Kinase binding	IPI	25512613
GO:0021889	Process	Olfactory bulb interneuron differentiation	IEA
GO:0021891	Process	Olfactory bulb interneuron development	IEA
GO:0021930	Process	Cerebellar granule cell precursor proliferation	IEA
GO:0021930	Process	Cerebellar granule cell precursor proliferation	ISS
GO:0021988	Process	Olfactory lobe development	IEA
GO:0035264	Process	Multicellular organism growth	IEA
GO:0042981	Process	Regulation of apoptotic process	IEA
GO:0043066	Process	Negative regulation of apoptotic process	IEA
GO:0043066	Process	Negative regulation of apoptotic process	IMP	21212266
GO:0043565	Function	Sequence-specific DNA binding	IEA
GO:0043565	Function	Sequence-specific DNA binding	ISS
GO:0045444	Process	Fat cell differentiation	IEA
GO:0045444	Process	Fat cell differentiation	IMP	24216764
GO:0045892	Process	Negative regulation of DNA-templated transcription	IDA	22528486
GO:0045893	Process	Positive regulation of DNA-templated transcription	IDA	21212266, 25512613
GO:0045893	Process	Positive regulation of DNA-templated transcription	ISS
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	16300731
GO:0046605	Process	Regulation of centrosome cycle	IDA	26213385
GO:0090575	Component	RNA polymerase II transcription regulator complex	IPI	20102225, 23661758
GO:1902750	Process	Negative regulation of cell cycle G2/M phase transition	IDA	22528486

MIM	HGNC	e!Ensembl
606398	790	ENSG00000169136

Q9Y2D1

Protein name

Cyclic AMP-dependent transcription factor ATF-5 (cAMP-dependent transcription factor ATF-5) (Activating transcription factor 5) (Transcription factor ATFx)

Protein function

Transcription factor that either stimulates or represses gene transcription through binding of different DNA regulatory elements such as cAMP response element (CRE) (consensus: 5'-GTGACGT[AC][AG]-3'), ATF5-specific response element (ARE) (consen

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00170	bZIP_1	206 → 268	bZIP transcription factor	Coiled-coil

Tissue specificity

TISSUE SPECIFICITY: Widely expressed with higher expression levels in liver. {ECO:0000269|PubMed:18332083}.

Sequence

MSLLATLGLELDRALLPASGLGWLVDYGKLPPAPAPLAPYEVLGGALEGGLPVGGEPLAG
DGFSDWMTERVDFTALLPLEPPLPPGTLPQPSPTPPDLEAMASLLKKELEQMEDFFLDAP
PLPPPSPPPLPPPPLPPAPSLPLSLPSFDLPQPPVLDTLDLLAIYCRNEAGQEEVGMPPL
PPPQQPPPPSPPQPSRLAPYPHPATTRGDRKQKKRDQNKSAALRYRQRKRAEGEALEGEC
QGLEARNRELKERAESVEREIQYVKDLLIEVYKARSQRTRSC

Sequence length

282

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (10)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
BIPOLAR DISORDER	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOMA	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HUNTINGTON DISEASE	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thymoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (47)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Astrocytoma	Astrocytoma	BEFREE	30584325		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia telangiectasia	Pubtator	38223508	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	17346882		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	LHGDN	17346882		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	PSYGENET_DG	17346882		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Carcinoma	Breast Carcinoma	BEFREE	21212266		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	25517360	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	21972289		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	17786276, 20495567		★★★★★ ★☆☆☆☆ Found in Text Mining only
Deafness	Deafness	Pubtator	34262025	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	34262025	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	16170340, 19046351, 21212266, 26943771, 27126996, 28489075, 29137451, 30584325		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	LHGDN	16170340		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	16254489, 26943771	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	16170340, 19046351, 21212266, 26943771, 27126996, 28489075, 29137451, 30584325		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	16170340, 19531563, 20495567, 21521685, 26365117, 28473657, 28595907		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioma	Glioma	Pubtator	26365117, 28595907	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hematological Disease	Hematological Disease	BEFREE	31524288		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemophagocytic Syndrome	Hemophagocytic Syndrome	BEFREE	18832568		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	12865944	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	28861715		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Immune System Diseases	Immune System Diseases	BEFREE	18832568		★★★★★ ★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune System Diseases	LHGDN	18832568		★★★★★ ★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune system disease	Pubtator	18832568	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intracranial Aneurysm	Intracranial aneurysm	Pubtator	29328431	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	21972289	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	28276286		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	LHGDN	18332083, 18701499		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	18701499, 19376136, 22528486		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	19376136		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	27125458	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphohistiocytosis Hemophagocytic	Hemophagocytic lymphohistiocytosis	Pubtator	18832568	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphohistiocytosis, Hemophagocytic	Lymphohistiocytosis	BEFREE	18832568		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphohistiocytosis, Hemophagocytic	Lymphohistiocytosis	LHGDN	18832568		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma Follicular	Lymphoma	Pubtator	26589882	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	20495567, 21725368, 25030919, 28595907		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	21212266		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	28718401		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	18701499, 25682872, 27126996, 28499833, 28718401, 29137451, 31676720		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	19046351		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental disorders	Mental Disorders	BEFREE	28744205		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	34262025	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	16170340, 18701499, 19046351, 21725368, 27126996, 28489075, 28595907, 28785242, 29137451, 30584325, 31676720		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	19046351		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	38014922	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	34262025	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Status Epilepticus	Status Epilepticus	BEFREE	28861715		★★★★★ ★☆☆☆☆ Found in Text Mining only

ATF5 (activating transcription factor 5)