FGFR4 (fibroblast growth factor receptor 4)

Gene

• Entrez ID: 2264
• Gene name: Fibroblast growth factor receptor 4
• Gene symbol: FGFR4
• Synonyms (NCBI Gene): CD334, JTK2, TKF
• Chromosome: 5
• Chromosome location: 5q35.2
• Summary: The protein encoded by this gene is a tyrosine kinase and cell surface receptor for fibroblast growth factors. The encoded protein is involved in the regulation of several pathways, including cell proliferation, cell differentiation, cell migration, lipid

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs351855	G>A	Pathogenic	Coding sequence variant, intron variant, missense variant
rs1057519792	C>A,G	Likely-pathogenic	Missense variant, coding sequence variant
rs1057519793	T>A	Likely-pathogenic	Missense variant, coding sequence variant
rs1057520036	A>G	Likely-pathogenic	Missense variant, coding sequence variant, intron variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT460224	hsa-miR-15a-5p	PAR-CLIP	23592263
MIRT460223	hsa-miR-15b-5p	PAR-CLIP	23592263
MIRT460222	hsa-miR-16-5p	PAR-CLIP	23592263
MIRT460221	hsa-miR-195-5p	PAR-CLIP	23592263
MIRT460220	hsa-miR-424-5p	PAR-CLIP	23592263
MIRT460219	hsa-miR-497-5p	PAR-CLIP	23592263
MIRT460217	hsa-miR-6838-5p	PAR-CLIP	23592263
MIRT460218	hsa-miR-6510-5p	PAR-CLIP	23592263
MIRT460216	hsa-miR-4716-3p	PAR-CLIP	23592263
MIRT460215	hsa-miR-6794-5p	PAR-CLIP	23592263
MIRT460214	hsa-miR-214-3p	PAR-CLIP	23592263
MIRT460212	hsa-miR-3619-5p	PAR-CLIP	23592263
MIRT460213	hsa-miR-761	PAR-CLIP	23592263
MIRT460211	hsa-miR-6798-5p	PAR-CLIP	23592263
MIRT460210	hsa-miR-1909-3p	PAR-CLIP	23592263
MIRT460209	hsa-miR-6722-3p	PAR-CLIP	23592263
MIRT460208	hsa-miR-6799-5p	PAR-CLIP	23592263
MIRT460207	hsa-miR-6825-5p	PAR-CLIP	23592263
MIRT460206	hsa-miR-4723-5p	PAR-CLIP	23592263
MIRT460205	hsa-miR-5698	PAR-CLIP	23592263
MIRT460204	hsa-miR-6870-5p	PAR-CLIP	23592263
MIRT460203	hsa-miR-7111-5p	PAR-CLIP	23592263
MIRT460202	hsa-miR-491-5p	PAR-CLIP	23592263
MIRT460201	hsa-miR-3151-5p	PAR-CLIP	23592263
MIRT460199	hsa-miR-4447	PAR-CLIP	23592263
MIRT460200	hsa-miR-4472	PAR-CLIP	23592263
MIRT460198	hsa-miR-6742-5p	PAR-CLIP	23592263
MIRT460197	hsa-miR-6796-5p	PAR-CLIP	23592263
MIRT736364	hsa-miR-486-3p	Luciferase reporter assay, Western blotting, Immunohistochemistry (IHC), qRT-PCR	32313144
MIRT460224	hsa-miR-15a-5p	PAR-CLIP	23592263
MIRT460223	hsa-miR-15b-5p	PAR-CLIP	23592263
MIRT460222	hsa-miR-16-5p	PAR-CLIP	23592263
MIRT460221	hsa-miR-195-5p	PAR-CLIP	23592263
MIRT460220	hsa-miR-424-5p	PAR-CLIP	23592263
MIRT460219	hsa-miR-497-5p	PAR-CLIP	23592263
MIRT460217	hsa-miR-6838-5p	PAR-CLIP	23592263
MIRT460218	hsa-miR-6510-5p	PAR-CLIP	23592263
MIRT460216	hsa-miR-4716-3p	PAR-CLIP	23592263
MIRT460215	hsa-miR-6794-5p	PAR-CLIP	23592263
MIRT460214	hsa-miR-214-3p	PAR-CLIP	23592263
MIRT460212	hsa-miR-3619-5p	PAR-CLIP	23592263
MIRT460213	hsa-miR-761	PAR-CLIP	23592263
MIRT460211	hsa-miR-6798-5p	PAR-CLIP	23592263
MIRT460210	hsa-miR-1909-3p	PAR-CLIP	23592263
MIRT460209	hsa-miR-6722-3p	PAR-CLIP	23592263
MIRT460208	hsa-miR-6799-5p	PAR-CLIP	23592263
MIRT460207	hsa-miR-6825-5p	PAR-CLIP	23592263
MIRT460206	hsa-miR-4723-5p	PAR-CLIP	23592263
MIRT460205	hsa-miR-5698	PAR-CLIP	23592263
MIRT460204	hsa-miR-6870-5p	PAR-CLIP	23592263
MIRT460203	hsa-miR-7111-5p	PAR-CLIP	23592263
MIRT460202	hsa-miR-491-5p	PAR-CLIP	23592263
MIRT460201	hsa-miR-3151-5p	PAR-CLIP	23592263
MIRT460199	hsa-miR-4447	PAR-CLIP	23592263
MIRT460200	hsa-miR-4472	PAR-CLIP	23592263
MIRT460198	hsa-miR-6742-5p	PAR-CLIP	23592263
MIRT460197	hsa-miR-6796-5p	PAR-CLIP	23592263
MIRT996188	hsa-miR-138	CLIP-seq
MIRT996189	hsa-miR-15a	CLIP-seq
MIRT996190	hsa-miR-15b	CLIP-seq
MIRT996191	hsa-miR-16	CLIP-seq
MIRT996192	hsa-miR-1827	CLIP-seq
MIRT996193	hsa-miR-1909	CLIP-seq
MIRT996194	hsa-miR-195	CLIP-seq
MIRT996195	hsa-miR-1976	CLIP-seq
MIRT996196	hsa-miR-2110	CLIP-seq
MIRT996197	hsa-miR-214	CLIP-seq
MIRT996198	hsa-miR-3151	CLIP-seq
MIRT996199	hsa-miR-3153	CLIP-seq
MIRT996200	hsa-miR-3177-3p	CLIP-seq
MIRT996201	hsa-miR-3612	CLIP-seq
MIRT996202	hsa-miR-3689a-3p	CLIP-seq
MIRT996203	hsa-miR-3689c	CLIP-seq
MIRT996204	hsa-miR-3689d	CLIP-seq
MIRT996205	hsa-miR-370	CLIP-seq
MIRT996206	hsa-miR-424	CLIP-seq
MIRT996207	hsa-miR-4271	CLIP-seq
MIRT996208	hsa-miR-4660	CLIP-seq
MIRT996209	hsa-miR-4725-3p	CLIP-seq
MIRT996210	hsa-miR-4728-5p	CLIP-seq
MIRT996211	hsa-miR-4731-5p	CLIP-seq
MIRT996212	hsa-miR-4774-5p	CLIP-seq
MIRT996213	hsa-miR-497	CLIP-seq
MIRT996214	hsa-miR-564	CLIP-seq
MIRT996215	hsa-miR-650	CLIP-seq
MIRT996216	hsa-miR-940	CLIP-seq
MIRT996217	hsa-miR-1247	CLIP-seq
MIRT996218	hsa-miR-1266	CLIP-seq
MIRT996189	hsa-miR-15a	CLIP-seq
MIRT996190	hsa-miR-15b	CLIP-seq
MIRT996191	hsa-miR-16	CLIP-seq
MIRT996193	hsa-miR-1909	CLIP-seq
MIRT996194	hsa-miR-195	CLIP-seq
MIRT996196	hsa-miR-2110	CLIP-seq
MIRT996197	hsa-miR-214	CLIP-seq
MIRT996219	hsa-miR-24	CLIP-seq
MIRT996198	hsa-miR-3151	CLIP-seq
MIRT996220	hsa-miR-3155	CLIP-seq
MIRT996221	hsa-miR-3155b	CLIP-seq
MIRT996222	hsa-miR-3157-5p	CLIP-seq
MIRT996204	hsa-miR-3689d	CLIP-seq
MIRT996223	hsa-miR-3925-3p	CLIP-seq
MIRT996206	hsa-miR-424	CLIP-seq
MIRT996207	hsa-miR-4271	CLIP-seq
MIRT996224	hsa-miR-4518	CLIP-seq
MIRT996225	hsa-miR-4524	CLIP-seq
MIRT996208	hsa-miR-4660	CLIP-seq
MIRT996226	hsa-miR-4691-3p	CLIP-seq
MIRT996209	hsa-miR-4725-3p	CLIP-seq
MIRT996211	hsa-miR-4731-5p	CLIP-seq
MIRT996227	hsa-miR-4755-3p	CLIP-seq
MIRT996228	hsa-miR-484	CLIP-seq
MIRT996213	hsa-miR-497	CLIP-seq
MIRT996229	hsa-miR-503	CLIP-seq
MIRT996230	hsa-miR-646	CLIP-seq
MIRT996231	hsa-miR-766	CLIP-seq
MIRT996189	hsa-miR-15a	CLIP-seq
MIRT996190	hsa-miR-15b	CLIP-seq
MIRT996191	hsa-miR-16	CLIP-seq
MIRT996193	hsa-miR-1909	CLIP-seq
MIRT996194	hsa-miR-195	CLIP-seq
MIRT996197	hsa-miR-214	CLIP-seq
MIRT996204	hsa-miR-3689d	CLIP-seq
MIRT996206	hsa-miR-424	CLIP-seq
MIRT996213	hsa-miR-497	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
IKZF1	Activation	11981041

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0004672	Function	Protein kinase activity	IEA
GO:0004713	Function	Protein tyrosine kinase activity	IEA
GO:0004714	Function	Transmembrane receptor protein tyrosine kinase activity	IEA
GO:0005007	Function	Fibroblast growth factor receptor activity	IBA
GO:0005007	Function	Fibroblast growth factor receptor activity	IDA	8663044, 18480409, 21653700
GO:0005007	Function	Fibroblast growth factor receptor activity	IEA
GO:0005007	Function	Fibroblast growth factor receptor activity	IGI	10525310
GO:0005007	Function	Fibroblast growth factor receptor activity	TAS	10918587
GO:0005515	Function	Protein binding	IPI	17627937, 20798051, 35384245
GO:0005524	Function	ATP binding	IEA
GO:0005576	Component	Extracellular region	IEA
GO:0005768	Component	Endosome	IEA
GO:0005783	Component	Endoplasmic reticulum	IDA	20683963
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005794	Component	Golgi apparatus	IDA	18061161
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	18061161, 20683963
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	10918587
GO:0005911	Component	Cell-cell junction	IDA	20798051
GO:0008201	Function	Heparin binding	IDA	18480409
GO:0008284	Process	Positive regulation of cell population proliferation	IBA
GO:0008284	Process	Positive regulation of cell population proliferation	IDA	8663044
GO:0008284	Process	Positive regulation of cell population proliferation	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IGI	8663044
GO:0008543	Process	Fibroblast growth factor receptor signaling pathway	IBA
GO:0008543	Process	Fibroblast growth factor receptor signaling pathway	IDA	18480409, 21653700
GO:0008543	Process	Fibroblast growth factor receptor signaling pathway	IEA
GO:0008543	Process	Fibroblast growth factor receptor signaling pathway	IGI	8663044
GO:0008543	Process	Fibroblast growth factor receptor signaling pathway	IPI	10525310
GO:0008543	Process	Fibroblast growth factor receptor signaling pathway	TAS	10918587
GO:0010468	Process	Regulation of gene expression	IEA
GO:0010628	Process	Positive regulation of gene expression	IMP	19085950
GO:0010715	Process	Regulation of extracellular matrix disassembly	IMP	20876804
GO:0016020	Component	Membrane	IEA
GO:0016301	Function	Kinase activity	IEA
GO:0016477	Process	Cell migration	IMP	20876804
GO:0016740	Function	Transferase activity	IEA
GO:0017134	Function	Fibroblast growth factor binding	IBA
GO:0017134	Function	Fibroblast growth factor binding	IDA	8663044, 18480409
GO:0017134	Function	Fibroblast growth factor binding	IEA
GO:0017134	Function	Fibroblast growth factor binding	IPI	10525310, 17627937
GO:0018108	Process	Peptidyl-tyrosine phosphorylation	IDA	20683963
GO:0019216	Process	Regulation of lipid metabolic process	ISS
GO:0030133	Component	Transport vesicle	IDA	18061161
GO:0042593	Process	Glucose homeostasis	ISS
GO:0042632	Process	Cholesterol homeostasis	ISS
GO:0043085	Process	Positive regulation of catalytic activity	IMP	20798051
GO:0043235	Component	Receptor complex	IBA
GO:0043410	Process	Positive regulation of MAPK cascade	IEA
GO:0045862	Process	Positive regulation of proteolysis	IMP	20798051
GO:0046777	Process	Protein autophosphorylation	IDA	20798051
GO:0055062	Process	Phosphate ion homeostasis	ISS
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IBA
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IMP	21653700
GO:0070857	Process	Regulation of bile acid biosynthetic process	IBA
GO:0070857	Process	Regulation of bile acid biosynthetic process	IEA
GO:0070857	Process	Regulation of bile acid biosynthetic process	IMP	17623664, 20683963
GO:1903412	Process	Response to bile acid	IMP	19085950
GO:2000573	Process	Positive regulation of DNA biosynthetic process	IMP	21653700

Other IDs

• MIM: 134935
• HGNC: 3691
• e!Ensembl: ENSG00000160867

Protein

• UniProt ID: P22455
• Protein name: Fibroblast growth factor receptor 4 (FGFR-4) (EC 2.7.10.1) (CD antigen CD334)
• Protein function: Tyrosine-protein kinase that acts as a cell-surface receptor for fibroblast growth factors and plays a role in the regulation of cell proliferation, differentiation and migration, and in regulation of lipid metabolism, bile acid biosynthesis, gl
• PDB: 4QQ5, 4QQC, 4QQJ, 4QQT, 4QRC, 4R6V, 4TYE, 4TYG, 4TYI, 4TYJ, 4UXQ, 4XCU, 5JKG, 5NUD, 5NWZ, 5XFF, 5XFJ, 6IUO, 6IUP, 6J6Y, 6JPE, 6JPJ, 6NVG, 6NVH, 6NVI, 6NVJ, 6NVK, 6V9C, 6YI8, 7DTZ, 7F3M, 7N1J, 7TYD, 7V29, 7VJL, 7WCT, 7WCW, 7WCX, 7YBO, 7YBP, 7YBX, 7YC1, 7YC3, 7YSW, 8KH6, 8KH7, 8KH8, 8KH9, 8W5C, 8XLQ
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF07679	I-set	154 → 241	Immunoglobulin I-set domain	Domain
  PF13927	Ig_3	248 → 337		Domain
  PF07714	PK_Tyr_Ser-Thr	467 → 743	Protein tyrosine and serine/threonine kinase	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed in gastrointestinal epithelial cells, pancreas, and gastric and pancreatic cancer cell lines. {ECO:0000269|PubMed:10631118}.
• Sequence:

  MRLLLALLGVLLSVPGPPVLSLEASEEVELEPCLAPSLEQQEQELTVALGQPVRLCCGRA
  ERGGHWYKEGSRLAPAGRVRGWRGRLEIASFLPEDAGRYLCLARGSMIVLQNLTLITGDS
  LTSSNDDEDPKSHRDPSNRHSYPQQAPYWTHPQRMEKKLHAVPAGNTVKFRCPAAGNPTP
  TIRWLKDGQAFHGENRIGGIRLRHQHWSLVMESVVPSDRGTYTCLVENAVGSIRYNYLLD
  VLERSPHRPILQAGLPANTTAVVGSDVELLCKVYSDAQPHIQWLKHIVINGSSFGADGFP
  YVQVLKTADINSSEVEVLYLRNVSAEDAGEYTCLAGNSIGLSYQSAWLTVLPEEDPTWTA
  AAPEARYTDIILYASGSLALAVLLLLAGLYRGQALHGRHPRPPATVQKLSRFPLARQFSL
  ESGSSGKSSSSLVRGVRLSSSGPALLAGLVSLDLPLDPLWEFPRDRLVLGKPLGEGCFGQ
  VVRAEAFGMDPARPDQASTVAVKMLKDNASDKDLADLVSEMEVMKLIGRHKNIINLLGVC
  TQEGPLYVIVECAAKGNLREFLRARRPPGPDLSPDGPRSSEGPLSFPVLVSCAYQVARGM
  QYLESRKCIHRDLAARNVLVTEDNVMKIADFGLARGVHHIDYYKKTSNGRLPVKWMAPEA
  LFDRVYTHQSDVWSFGILLWEIFTLGGSPYPGIPVEELFSLLREGHRMDRPPHCPPELYG
  LMRECWHAAPSQRPTFKQLVEALDKVLLAVSEEYLDLRLTFGPYSPSGGDASSTCSSSDS
  VFSHDPLPLGSSSFPFGSGVQT

• Sequence length: 802

Pathways

KEGG:

MAPK signaling pathway
Ras signaling pathway
Rap1 signaling pathway
Calcium signaling pathway
Endocytosis
PI3K-Akt signaling pathway
Signaling pathways regulating pluripotency of stem cells
Regulation of actin cytoskeleton
Pathways in cancer

Reactome:

PI3K Cascade
PIP3 activates AKT signaling
betaKlotho-mediated ligand binding
FGFR4 mutant receptor activation
FGFR4 ligand binding and activation
Constitutive Signaling by Aberrant PI3K in Cancer
Phospholipase C-mediated cascade; FGFR4
FRS-mediated FGFR4 signaling
SHC-mediated cascade:FGFR4
PI-3K cascade:FGFR4
Negative regulation of FGFR4 signaling
Signaling by FGFR4 in disease
RAF/MAP kinase cascade
PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
Cancer progression and tumor cell motility	Conflicting classifications of pathogenicity	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, ADENOID CYSTIC	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHOLELITHIASIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Classic Hodgkin lymphoma	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Embryonal rhabdomyosarcoma	-	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FGFR4-related disorder	Benign; Likely benign; Conflicting classifications of pathogenicity	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FOCAL SEGMENTAL GLOMERULOSCLEROSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neoplasm	-	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rhabdomyosarcoma	-	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma	Adenocarcinoma	BEFREE	31527546		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	16061909, 17487277, 19296538, 23699534		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	UNIPROT_DG			★☆☆☆☆ Found in Text Mining only
Adenoid Cystic Carcinoma	Adenocarcinoma	CTD_human_DG	23685749		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	30517925		★☆☆☆☆ Found in Text Mining only
Adenoma of large intestine	Colorectal adenoma	BEFREE	30517925		★☆☆☆☆ Found in Text Mining only
Adrenocortical Carcinoma	Adrenocortical carcinoma	Pubtator	34956100	Associate	★☆☆☆☆ Found in Text Mining only
Adult Hepatocellular Carcinoma	Liver carcinoma	BEFREE	31409633		★☆☆☆☆ Found in Text Mining only
Alveolar rhabdomyosarcoma	Alveolar Rhabdomyosarcoma	BEFREE	21882254, 22648271		★☆☆☆☆ Found in Text Mining only
Anaplastic astrocytoma	Anaplastic Astrocytoma	BEFREE	11958417, 16198476		★☆☆☆☆ Found in Text Mining only
Anaplastic thyroid carcinoma	Anaplastic thyroid cancer	BEFREE	28178124		★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	21109934		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	22587598		★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	11958417, 15981099, 7905605		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	22587598		★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	BEFREE	30953354		★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	21567388		★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	18756523		★☆☆☆☆ Found in Text Mining only
Biliary Atresia	Biliary Atresia	BEFREE	30156739		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	17088904		★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	27926948	Associate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	11549253, 14601095, 14710228, 16012724, 16109476, 16822847, 17084840, 19500394, 19946327, 20066896, 20147743, 21037081, 21625954, 21656577, 22034009, 22731805, 23384775, 25349422, 26152288, 26431494, 29344186, 29603419, 29763898, 30074276, 30903103, 7534069		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	14601095, 15377668, 19240166, 20147743, 23226373, 25349422, 26152288, 26431494, 27192118, 27926948, 29763898, 30359238, 32381997, 32710281, 33446698, 33838601, 35562334, 7680645	Associate	★☆☆☆☆ Found in Text Mining only
Bronchopulmonary Dysplasia	Bronchopulmonary Dysplasia	BEFREE	24288432		★☆☆☆☆ Found in Text Mining only
Bronchopulmonary Dysplasia	Bronchopulmonary dysplasia	Pubtator	24288432	Associate	★☆☆☆☆ Found in Text Mining only
Cap Myopathy	Cap myopathy	Pubtator	15655558	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	12937159, 21567388, 25686244	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	18756523		★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	31878098	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	22309595, 22439738, 24324363, 25860955, 26498355, 27447573, 28069043, 28445152, 31575541, 32555680, 33051476, 33754043, 33794926, 35466502, 36179047, 36419260, 37489553, 38048735, 40547312	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	32677805	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	17088904		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	17519899, 18949411, 19296538, 29402970		★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	35513870	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	34061869, 35963908	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	33668731	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	27154171, 28583379, 32596330	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Basal Cell	Carcinoma	BEFREE	19500394		★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	23344261, 26323668		★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	BEFREE	27725315		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	28650667, 31575945		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	33126883	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	23206452	Associate	★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	24239227		★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	28378614, 28870344, 29982249		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	28870344, 29982249		★☆☆☆☆ Found in Text Mining only
Childhood Hepatocellular Carcinoma	Liver carcinoma	BEFREE	31409633		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	24565842		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	28255027, 28445152, 34981854, 36190545, 36462464, 37817227	Associate	★☆☆☆☆ Found in Text Mining only
Cholecystolithiasis	Cholecystolithiasis	BEFREE	22535390		★☆☆☆☆ Found in Text Mining only
Cholelithiasis	Cholelithiasis	BEFREE	22535390		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chronic Kidney Diseases	Kidney Disease	BEFREE	26437603, 26759036, 27725315, 28512310, 31575945		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	29748308, 30538676		★☆☆☆☆ Found in Text Mining only
Cirrhosis Familial	Cirrhosis	Pubtator	36190545	Associate	★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	15448004, 17599042, 24503538, 26183471		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	LHGDN	16012724, 17599042		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	BEFREE	17599042		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	14601095, 16012724, 16455651, 19051325, 22971346, 23696849, 24410190, 24503538, 29048661, 29884889, 31555396		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	19638618, 22465712, 22971346, 24503538, 27650548, 27857023, 32533590, 33034614, 36923538, 37083591	Associate	★☆☆☆☆ Found in Text Mining only
Congenital atresia of extrahepatic bile duct	Extrahepatic Biliary Atresia	BEFREE	30156739		★☆☆☆☆ Found in Text Mining only
Congenital contractural arachnodactyly	Congenital Contractural Arachnodactyly	BEFREE	24565842		★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	27725315, 30669147		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	10208873		★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	22313031, 22696188		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	22313031, 22587598, 22696188		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	22313031	Associate	★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	22313031, 22696188, 30564136		★☆☆☆☆ Found in Text Mining only
Craniosynostosis	Craniosynostosis	BEFREE	9682222		★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	30538676		★☆☆☆☆ Found in Text Mining only
Desmoplastic Small Round Cell Tumor	Desmoplastic small round cell tumor	Pubtator	32393201, 32703985, 33753552	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	23747250, 25204652		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	23206452	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	23747250, 25204652		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	23747250		★☆☆☆☆ Found in Text Mining only
Diarrhea	Diarrhea	Pubtator	22271411, 37270847	Associate	★☆☆☆☆ Found in Text Mining only
Diffuse Astrocytoma	Astrocytoma	BEFREE	11958417		★☆☆☆☆ Found in Text Mining only
Eclampsia	Eclampsia	BEFREE	21827571		★☆☆☆☆ Found in Text Mining only
Embryonal Rhabdomyosarcoma	Embryonal Rhabdomyosarcoma	BEFREE	25349422		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Endometriosis	Endometriosis	Pubtator	37789421	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	25989802		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	25989802		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	25989802	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	25989802	Associate	★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty liver	Pubtator	27447573	Stimulate	★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty liver	Pubtator	37895284	Associate	★☆☆☆☆ Found in Text Mining only
Fibroadenoma	Fibroadenoma	BEFREE	11271786		★☆☆☆☆ Found in Text Mining only
Follicular thyroid carcinoma	Follicular Thyroid Carcinoma	BEFREE	29438906		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Neoplasms	Gastrointestinal Neoplasms	BEFREE	11166921		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	Pubtator	31948066	Associate	★☆☆☆☆ Found in Text Mining only
Gastroschisis	Gastroschisis	Pubtator	31075877	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	11958417		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	11958417, 16198476, 21555372		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	36462464	Associate	★☆☆☆☆ Found in Text Mining only
Growth Hormone-Secreting Pituitary Adenoma	Somatotroph Adenoma	BEFREE	18070145		★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	18487077, 19008009		★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head And Neck Neoplasms	LHGDN	18349267		★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	23226373, 34768995	Associate	★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	27725315, 30669147		★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	30634399		★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	11271786	Associate	★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington disease	Pubtator	33049985	Associate	★☆☆☆☆ Found in Text Mining only
Hypercalcemia	Hypercalcemia	BEFREE	24670087		★☆☆☆☆ Found in Text Mining only
Hypercalcemia	Hypercalcemia	Pubtator	24670087	Associate	★☆☆☆☆ Found in Text Mining only
Hypercalcemia Infantile	Idiopathic infantile hypercalcemia	Pubtator	24670087	Associate	★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Hypercholesterolemia	BEFREE	28843503		★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	28650667		★☆☆☆☆ Found in Text Mining only
Hypertrophy Left Ventricular	Left ventricular disease	Pubtator	26681731	Associate	★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholangiocarcinoma	Intrahepatic Cholangiocarcinoma	BEFREE	24565842, 28445152		★☆☆☆☆ Found in Text Mining only
Invasive Ductal Breast Carcinoma	Invasive Duct and Lobular Carcinoma	BEFREE	26152288		★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable bowel syndrome	Pubtator	21396369, 22271411, 22610000, 24200957	Associate	★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable Bowel Syndrome	BEFREE	22403795, 24200957		★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	23206452, 24239227		★☆☆☆☆ Found in Text Mining only
Islet Cell Tumor	Islet Cell Tumor	BEFREE	22986737		★☆☆☆☆ Found in Text Mining only
Ki-1+ Anaplastic Large Cell Lymphoma	Anaplastic Lymphoma	BEFREE	7504515		★☆☆☆☆ Found in Text Mining only
Kidney Failure Chronic	Kidney failure	Pubtator	21567388	Associate	★☆☆☆☆ Found in Text Mining only
Left Ventricular Hypertrophy	Left Ventricular Hypertrophy	BEFREE	26437603, 26759036, 28339837, 28512310, 29309658, 29735309, 31758962		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	1638019	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	1377018		★☆☆☆☆ Found in Text Mining only
Limb Deformities, Congenital	Congenital anomaly of limb	BEFREE	23342975		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	19008009, 20018895, 20657013, 21319186, 21540647, 21656577, 22309595, 22439738, 2284097, 24728076, 25031272, 25346390, 25860955, 26481559, 26498355, 28249259, 28445152, 28983785, 29247039, 29432567, 29468415, 29490293, 30403487, 30698907, 31146605, 31167419, 31305210, 31409633, 31413803, 31529503, 31575540, 31575541, 31759109		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	LHGDN	19008009		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	21656577, 25860955		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liver Cirrhosis	Liver cirrhosis	Pubtator	25860955	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liver Failure	Liver failure	BEFREE	28709961		★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	20657013, 25031272, 31350344		★☆☆☆☆ Found in Text Mining only
Liver Neoplasms	Liver neoplasm	Pubtator	27447573	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	LHGDN	17519899		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	23836671, 32781755	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	40547312	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	25989802	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	27154171	Inhibit	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	28056982, 36142417	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	24248544, 24381107		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin, Familial	Lymphoma	BEFREE	24248544, 24381107		★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	16198476		★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	18487077		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	11549253, 14710228, 15377668, 16012724, 16109476, 16822847, 17084840, 19500394, 19946327, 20066896, 20147743, 21037081, 21625954, 21656577, 22034009, 22731805, 23384775, 26152288, 26431494, 29344186, 29603419, 29763898, 30074276, 30903103, 7534069		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	25989802		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	31350344, 31409633		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	17519899, 18949411, 19296538, 26675719, 28465216, 29402970		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	23344261, 26323668		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	21109934, 23384775		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	15448004, 16061909, 16927306, 17607666, 18670643, 18756523, 18762813, 19918264, 21349172, 21622724, 21625079, 22573348, 27640814		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CTD_human_DG	15448004		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	UNIPROT_DG	18670643, 18756523, 20876804, 21349172		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of skin	Skin cancer	BEFREE	19500394		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	20844967, 21567388, 23901234, 24126887, 26432329, 26662569, 31601997		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	15564323, 29438906		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	17088904		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	11003564, 11830541, 11958417, 15475466, 16061909, 16721364, 17519899, 17607666, 18487077, 19082487, 19809159, 19940159, 19946327, 20638838, 20660043, 20876804, 21037081, 21412156, 21656577, 22034009, 22971346, 23316053, 23699534, 23747250, 23901234, 23944363, 24248544, 24381107, 24728076, 24870599, 25860955, 26840079, 27640814, 28445975, 28583379, 28650667, 28718374, 29402970, 29557750, 29603419, 30070748, 30325210, 30518874, 30634399, 31350344, 31409633, 31575540		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	28870344, 29982249		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	15448004, 17599042, 24503538, 26183471		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	12815007, 16012724, 16109476, 18310279		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	CLINVAR_DG	19946327		★☆☆☆☆ Found in Text Mining only
Mandibulofacial Dysostosis	Mandibulofacial Dysostosis	BEFREE	8276417		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	16721364, 19008009		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	16721364, 21753785	Associate	★☆☆☆☆ Found in Text Mining only
Melanoma Cutaneous Malignant	Melanoma	Pubtator	19500394	Associate	★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	31527449	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic syndrome	Pubtator	37895284	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	24870599		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	24870599	Associate	★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	18794796, 23316053, 29284153, 29507701		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	11562460, 11830541, 11958417, 14611677, 15197773, 15475466, 15564323, 15981099, 16109476, 16198476, 16721364, 17084840, 18056464, 18070145, 18310279, 18593907, 18657378, 19008009, 19051325, 19809159, 19946327, 20127014, 20657013, 20876804, 21037081, 21109934, 21412928, 21540647, 22034009, 22648271, 22971346, 22986737, 23226373, 23696849, 23901234, 23944363, 24503538, 2555699, 27183356, 27267848, 27857023, 28249259, 29344186, 29763898, 30116384, 30267473, 30517925, 31128178, 31179224, 31575540, 31601997, 7705943		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	26840079		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	26840079, 37006072	Associate	★☆☆☆☆ Found in Text Mining only
Neuroectodermal Tumor, Primitive	Neuroectodermal Tumors	BEFREE	22986737		★☆☆☆☆ Found in Text Mining only
Neuroendocrine Tumors	Neuroendocrine Tumors	BEFREE	26335532		★☆☆☆☆ Found in Text Mining only
Neurofibrosarcoma	Neurofibrosarcoma	Pubtator	26993773	Associate	★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	21616061, 28774887, 31655133		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	18949411, 23524567, 25975224, 29402970, 30267839		★☆☆☆☆ Found in Text Mining only
NONAKA MYOPATHY	Inclusion body myopathy	BEFREE	29776409		★☆☆☆☆ Found in Text Mining only
Oral Submucous Fibrosis	Oral submucous fibrosis	Pubtator	38050610	Associate	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	14601095		★☆☆☆☆ Found in Text Mining only
Ovarian Carcinoma	Ovarian Carcinoma	BEFREE	23344261		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	11072239, 23344261, 26323668, 8099571		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	38154497	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	21109934, 23384775		★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	21109934		★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	29438906		★☆☆☆☆ Found in Text Mining only
Phosphate Diabetes	Phosphate Diabetes	BEFREE	31575945		★☆☆☆☆ Found in Text Mining only
Pituitary Adenoma	Pituitary adenoma	BEFREE	27267848		★☆☆☆☆ Found in Text Mining only
Pituitary Neoplasms	Pituitary neoplasm	Pubtator	12937159	Associate	★☆☆☆☆ Found in Text Mining only
Pituitary Neoplasms	Pituitary Neoplasms	LHGDN	15070963		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	15448004, 16061909, 16927306, 17607666, 18670643, 18756523, 18762813, 19918264, 20876804, 21349172, 21622724, 21625079, 22573348, 27640814		★☆☆☆☆ Found in Text Mining only
Prostatic Hyperplasia	Prostatic hyperplasia	Pubtator	15655558	Stimulate	★☆☆☆☆ Found in Text Mining only
Prostatic Hyperplasia	Prostatic Hyperplasia	LHGDN	18756523		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	15448004, 18670643, 18756523		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	CTD_human_DG	15448004		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	18670643, 18762813, 21622724, 27640814, 33446698	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	10208873		★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Adult	Respiratory Distress Syndrome	CTD_human_DG	25070658		★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Newborn	Congenital alveolar dysplasia	BEFREE	24288432		★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	Pubtator	31207142	Associate	★☆☆☆☆ Found in Text Mining only
Rhabdoid Tumor Predisposition Syndrome 1	Rhabdoid tumor predisposition syndrome	Pubtator	37726478	Associate	★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	BEFREE	15475466, 19809159, 22648271, 23696246, 24124571, 29487419, 31128178		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rhabdomyosarcoma	Rhabdomyosarcoma	CLINVAR_DG	19809159, 24124571		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rhabdomyosarcoma	Rhabdomyosarcoma	Pubtator	32464274, 32532875, 34095712, 34768995, 34850536, 39368853	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rhabdomyosarcoma	Rhabdomyosarcoma	CGI_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rhabdomyosarcoma Alveolar	Rhabdomyosarcoma	Pubtator	32464274	Associate	★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma Embryonal	Rhabdomyosarcoma	Pubtator	25349422	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	14601095, 17084840, 21656577		★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	Pubtator	14601095, 23226373, 29881993, 38625071	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma Synovial	Synovial sarcoma	Pubtator	23664540	Associate	★☆☆☆☆ Found in Text Mining only
Situs ambiguus	Situs ambiguus	BEFREE	30564136		★☆☆☆☆ Found in Text Mining only
Sotos Syndrome	Sotos syndrome	Pubtator	24670087	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	19500394, 20127014, 23226373, 29221201		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	25989802, 30267473		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	23226373, 23481570, 34576070	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of lung	Lung carcinoma	BEFREE	27581340, 28583379		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of mouth	Oral cavity carcinoma	BEFREE	23226373		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of oropharynx	Oropharyngeal carcinoma	BEFREE	26551585		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	15197773, 17084840, 18487077, 22576800		★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	21616061		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	20844967, 21567388, 23901234, 24126887, 26432329, 26662569, 31601997		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	11003564, 21567388, 23901234, 25684949, 28056982, 32599983, 37945798	Associate	★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	23206452	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	15564323, 29438906		★☆☆☆☆ Found in Text Mining only
Thyroid Carcinoma Anaplastic	Thyroid cancer	Pubtator	28178124	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	15564323, 29438906		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	LHGDN	15564323		★☆☆☆☆ Found in Text Mining only
Tumors of Adrenal Cortex	Tumors Of Adrenal Cortex	BEFREE	21468523		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	36462464	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	27154171, 32951893, 34951738	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Fibroids	Uterine Fibroids	BEFREE	31649266		★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal melanoma	Pubtator	33126538	Associate	★☆☆☆☆ Found in Text Mining only