Gene Gene information from NCBI Gene database.
Entrez ID 2263
Gene name Fibroblast growth factor receptor 2
Gene symbol FGFR2
Synonyms (NCBI Gene)
BBDSBEKBFR-1CD332CEK3CFD1ECT1JWSK-SAMKGFRTK14TK25
Chromosome 10
Chromosome location 10q26.13
Summary The protein encoded by this gene is a member of the fibroblast growth factor receptor family, where amino acid sequence is highly conserved between members and throughout evolution. FGFR family members differ from one another in their ligand affinities an
SNPs SNP information provided by dbSNP.
86
SNP ID Visualize variation Clinical significance Consequence
rs3135755 A>C Conflicting-interpretations-of-pathogenicity Intron variant, coding sequence variant, synonymous variant, 5 prime UTR variant, non coding transcript variant
rs77543610 G>A,C Pathogenic, likely-pathogenic, uncertain-significance Intron variant, 5 prime UTR variant, missense variant, coding sequence variant, non coding transcript variant
rs79184941 G>A,C Pathogenic, likely-pathogenic, benign-likely-benign Intron variant, 5 prime UTR variant, missense variant, coding sequence variant, non coding transcript variant
rs121913474 A>G Uncertain-significance, likely-pathogenic 5 prime UTR variant, missense variant, non coding transcript variant, coding sequence variant, intron variant
rs121913475 T>C Likely-pathogenic 5 prime UTR variant, missense variant, non coding transcript variant, coding sequence variant, intron variant
miRNA miRNA information provided by mirtarbase database.
106
miRTarBase ID miRNA Experiments Reference
MIRT006275 hsa-miR-19b-1-5p Luciferase reporter assayWestern blot 22197821
MIRT006275 hsa-miR-19b-1-5p Luciferase reporter assayWestern blot 22197821
MIRT006275 hsa-miR-19b-1-5p Luciferase reporter assayWestern blot 22197821
MIRT006275 hsa-miR-19b-1-5p Luciferase reporter assayWestern blot 22197821
MIRT006275 hsa-miR-19b-1-5p Luciferase reporter assayWestern blot 22197821
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
153
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II ISS
GO:0000166 Function Nucleotide binding IEA
GO:0001525 Process Angiogenesis IBA
GO:0001525 Process Angiogenesis ISS
GO:0001657 Process Ureteric bud development ISS
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
176943 3689 ENSG00000066468
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P21802
Protein name Fibroblast growth factor receptor 2 (FGFR-2) (EC 2.7.10.1) (K-sam) (KGFR) (Keratinocyte growth factor receptor) (CD antigen CD332)
Protein function Tyrosine-protein kinase that acts as a cell-surface receptor for fibroblast growth factors and plays an essential role in the regulation of cell proliferation, differentiation, migration and apoptosis, and in the regulation of embryonic developm
PDB 1DJS , 1E0O , 1EV2 , 1GJO , 1II4 , 1IIL , 1NUN , 1OEC , 1WVZ , 2FDB , 2PSQ , 2PVF , 2PVY , 2PWL , 2PY3 , 2PZ5 , 2PZP , 2PZR , 2Q0B , 3B2T , 3CAF , 3CLY , 3CU1 , 3DAR , 3EUU , 3OJ2 , 3OJM , 3RI1 , 4J23 , 4J95 , 4J96 , 4J97 , 4J98 , 4J99 , 4WV1 , 5EG3 , 5UGL , 5UGX , 5UHN , 5UI0 , 6AGX , 6LVK , 6LVL , 6V6Q , 7KIA , 7KIE , 7OZY , 8E1X , 8H75 , 8STG , 8SWE
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF07679 I-set 162 248 Immunoglobulin I-set domain Domain
PF07679 I-set 260 359 Immunoglobulin I-set domain Domain
PF18123 FGFR3_TM 371 401 Fibroblast growth factor receptor 3 transmembrane domain Domain
PF07714 PK_Tyr_Ser-Thr 481 757 Protein tyrosine and serine/threonine kinase Domain
Sequence
MVSWGRFICLVVVTMATLSLARPSFSLVEDTTLEPEEPPTKYQISQPEVYVAAPGESLEV
RCLLKDAAVISWTKDGVHLGPNNRTVLIGEYLQIKGATPRDSGLYACTASRTVDSETWYF
MVNVTDAISSGDDEDDTDGAEDFVSENSNNKRAPYWTNTEKMEKRLHAVPAANTVKFRCP
AGGNPMPTMRWLKNGKEFKQEHRIGGYKVRNQHWSLIMESVVPSDKGNYTCVVENEYGSI
NHTYHLDV
VERSPHRPILQAGLPANASTVVGGDVEFVCKVYSDAQPHIQWIKHVEKNGSK
YGPDGLPYLKVLKAAGVNTTDKEIEVLYIRNVTFEDAGEYTCLAGNSIGISFHSAWLTV
L
PAPGREKEITASPDYLEIAIYCIGVFLIACMVVTVILCRMKNTTKKPDFSSQPAVHKLTK
RIPLRRQVTVSAESSSSMNSNTPLVRITTRLSSTADTPMLAGVSEYELPEDPKWEFPRDK
LTLGKPLGEGCFGQVVMAEAVGIDKDKPKEAVTVAVKMLKDDATEKDLSDLVSEMEMMKM
IGKHKNIINLLGACTQDGPLYVIVEYASKGNLREYLRARRPPGMEYSYDINRVPEEQMTF
KDLVSCTYQLARGMEYLASQKCIHRDLAARNVLVTENNVMKIADFGLARDINNIDYYKKT
TNGRLPVKWMAPEALFDRVYTHQSDVWSFGVLMWEIFTLGGSPYPGIPVEELFKLLKEGH
RMDKPANCTNELYMMMRDCWHAVPSQRPTFKQLVEDL
DRILTLTTNEEYLDLSQPLEQYS
PSYPDTRSSCSSGDDSVFSPDPMPYEPCLPQYPHINGSVKT
Sequence length 821
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  EGFR tyrosine kinase inhibitor resistance
MAPK signaling pathway
Ras signaling pathway
Rap1 signaling pathway
Calcium signaling pathway
Endocytosis
PI3K-Akt signaling pathway
Signaling pathways regulating pluripotency of stem cells
Regulation of actin cytoskeleton
Pathways in cancer
Prostate cancer
Gastric cancer
Central carbon metabolism in cancer
  PI3K Cascade
PIP3 activates AKT signaling
FGFR2c ligand binding and activation
FGFR2b ligand binding and activation
Signaling by FGFR2 amplification mutants
Activated point mutants of FGFR2
Constitutive Signaling by Aberrant PI3K in Cancer
Phospholipase C-mediated cascade; FGFR2
PI-3K cascade:FGFR2
SHC-mediated cascade:FGFR2
FRS-mediated FGFR2 signaling
Negative regulation of FGFR2 signaling
Signaling by FGFR2 in disease
RAF/MAP kinase cascade
PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling
Signaling by FGFR2 fusions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
134
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession Evidence Score
Acrocephalosyndactyly type I Pathogenic; Likely pathogenic rs121918490, rs1057519041, rs121918491, rs79184941, rs77543610, rs121918498, rs879253721, rs1434545235, rs387907372 RCV002246353
RCV002249988
RCV002247335
RCV000014191
RCV000014193
View all (4 more)
★★★★★
ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Adenoid cystic carcinoma Likely pathogenic; Pathogenic rs121913474 RCV004813093
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Antley-Bixler syndrome without genital anomalies or disordered steroidogenesis Likely pathogenic; Pathogenic rs121918487, rs121918488, rs77543610, rs121918502 RCV001196204
RCV000014180
RCV000014183
RCV001197223
RCV000014209
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Aural atresia, congenital Pathogenic rs121918499 RCV002254264
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
Acute myeloid leukemia Benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
ANKYLOSIS CTD
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
ANTLEY-BIXLER SYNDROME Disgenet, GWAS catalog
Disgenet, GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
ANTLEY-BIXLER SYNDROME PHENOTYPE CTD
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
2-3 toe syndactyly Syndactyly Of The Toes HPO_DG
★☆☆☆☆
Found in Text Mining only
Absence of septum pellucidum Absence Of Septum Pellucidum HPO_DG
★☆☆☆☆
Found in Text Mining only
Acanthosis Nigricans Acanthosis Nigricans BEFREE 19387476
★☆☆☆☆
Found in Text Mining only
Acanthosis Nigricans Acanthosis Nigricans HPO_DG
★☆☆☆☆
Found in Text Mining only
Achondroplasia Achondroplasia BEFREE 10712195
★☆☆☆☆
Found in Text Mining only
Achondroplasia Achondroplasia Pubtator 10712195, 17525745, 22879958 Associate
★☆☆☆☆
Found in Text Mining only
Acne Acne HPO_DG
★☆☆☆☆
Found in Text Mining only
Acrobrachycephaly Acrobrachycephaly HPO_DG
★☆☆☆☆
Found in Text Mining only
Acrocephalosyndactylia Acrocephalopolydactyly CLINVAR_DG 10851026
★☆☆☆☆
Found in Text Mining only
Acrocephalosyndactylia Acrocephalopolydactyly LHGDN 11556600, 15622262, 15829502, 16440883, 17189145, 17251833, 17622301, 18671283
★☆☆☆☆
Found in Text Mining only