Gene Gene information from NCBI Gene database.
Entrez ID 2260
Gene name Fibroblast growth factor receptor 1
Gene symbol FGFR1
Synonyms (NCBI Gene)
BFGFRCD331CEKECCLFGFBRFGFR-1FLGFLT-2FLT2HBGFRHH2HRTFDSKAL2N-SAMOGDbFGF-R-1
Chromosome 8
Chromosome location 8p11.23
Summary The protein encoded by this gene is a member of the fibroblast growth factor receptor (FGFR) family, where amino acid sequence is highly conserved between members and throughout evolution. FGFR family members differ from one another in their ligand affini
SNPs SNP information provided by dbSNP.
99
SNP ID Visualize variation Clinical significance Consequence
rs121909627 G>C Pathogenic Upstream transcript variant, genic upstream transcript variant, coding sequence variant, missense variant, 5 prime UTR variant, non coding transcript variant
rs121909628 G>A,C Risk-factor, pathogenic, likely-pathogenic Stop gained, coding sequence variant, genic downstream transcript variant, missense variant, non coding transcript variant
rs121909629 C>T Risk-factor Genic downstream transcript variant, missense variant, non coding transcript variant, coding sequence variant
rs121909630 C>A Pathogenic Genic upstream transcript variant, coding sequence variant, missense variant, 5 prime UTR variant, non coding transcript variant
rs121909631 T>C Pathogenic Genic downstream transcript variant, missense variant, non coding transcript variant, coding sequence variant
miRNA miRNA information provided by mirtarbase database.
642
miRTarBase ID miRNA Experiments Reference
MIRT003228 hsa-miR-424-5p Luciferase reporter assay 20065103
MIRT006795 hsa-miR-16-5p Luciferase reporter assayqRT-PCRWestern blot 21885851
MIRT007113 hsa-miR-133b Luciferase reporter assayWestern blot 23296701
MIRT007113 hsa-miR-133b Luciferase reporter assayWestern blot 23296701
MIRT007113 hsa-miR-133b ImmunohistochemistryLuciferase reporter assayqRT-PCRWestern blot 23296701
Transcription factors Transcription factors information provided by TRRUST V2 database.
4
Transcription factor Regulation Reference
E2F1 Activation 19303924
KLF10 Repression 23569208
RB1 Repression 19303924
SP1 Unknown 23569208
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
138
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IEA
GO:0000165 Process MAPK cascade TAS 10748122
GO:0000166 Function Nucleotide binding IEA
GO:0001501 Process Skeletal system development TAS 7874169
GO:0001525 Process Angiogenesis IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
136350 3688 ENSG00000077782
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P11362
Protein name Fibroblast growth factor receptor 1 (FGFR-1) (EC 2.7.10.1) (Basic fibroblast growth factor receptor 1) (BFGFR) (bFGF-R-1) (Fms-like tyrosine kinase 2) (FLT-2) (N-sam) (Proto-oncogene c-Fgr) (CD antigen CD331)
Protein function Tyrosine-protein kinase that acts as a cell-surface receptor for fibroblast growth factors and plays an essential role in the regulation of embryonic development, cell proliferation, differentiation and migration. Required for normal mesoderm pa
PDB 1AGW , 1CVS , 1EVT , 1FGI , 1FGK , 1FQ9 , 1XR0 , 2CR3 , 2FGI , 3C4F , 3DPK , 3GQI , 3GQL , 3JS2 , 3KRJ , 3KRL , 3KXX , 3KY2 , 3OJV , 3RHX , 3TT0 , 4F63 , 4F64 , 4F65 , 4NK9 , 4NKA , 4NKS , 4RWI , 4RWJ , 4RWK , 4RWL , 4UWB , 4UWC , 4UWY , 4V01 , 4V04 , 4V05 , 4WUN , 4ZSA , 5A46 , 5A4C , 5AM6 , 5AM7 , 5B7V , 5EW8 , 5FLF , 5O49 , 5O4A , 5UQ0 , 5UR1 , 5VND
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00047 ig 38 116 Immunoglobulin domain Domain
PF07679 I-set 160 247 Immunoglobulin I-set domain Domain
PF07679 I-set 259 358 Immunoglobulin I-set domain Domain
PF18123 FGFR3_TM 370 400 Fibroblast growth factor receptor 3 transmembrane domain Domain
PF07714 PK_Tyr_Ser-Thr 478 754 Protein tyrosine and serine/threonine kinase Domain
Tissue specificity TISSUE SPECIFICITY: Detected in astrocytoma, neuroblastoma and adrenal cortex cell lines. Some isoforms are detected in foreskin fibroblast cell lines, however isoform 17, isoform 18 and isoform 19 are not detected in these cells. {ECO:0000269|PubMed:1652
Sequence
MWSWKCLLFWAVLVTATLCTARPSPTLPEQAQPWGAPVEVESFLVHPGDLLQLRCRLRDD
VQSINWLRDGVQLAESNRTRITGEEVEVQDSVPADSGLYACVTSSPSGSDTTYFSV
NVSD
ALPSSEDDDDDDDSSSEEKETDNTKPNRMPVAPYWTSPEKMEKKLHAVPAAKTVKFKCPS
SGTPNPTLRWLKNGKEFKPDHRIGGYKVRYATWSIIMDSVVPSDKGNYTCIVENEYGSIN
HTYQLDV
VERSPHRPILQAGLPANKTVALGSNVEFMCKVYSDPQPHIQWLKHIEVNGSKI
GPDNLPYVQILKTAGVNTTDKEMEVLHLRNVSFEDAGEYTCLAGNSIGLSHHSAWLTV
LE
ALEERPAVMTSPLYLEIIIYCTGAFLISCMVGSVIVYKMKSGTKKSDFHSQMAVHKLAKS
IPLRRQVTVSADSSASMNSGVLLVRPSRLSSSGTPMLAGVSEYELPEDPRWELPRDRLVL
GKPLGEGCFGQVVLAEAIGLDKDKPNRVTKVAVKMLKSDATEKDLSDLISEMEMMKMIGK
HKNIINLLGACTQDGPLYVIVEYASKGNLREYLQARRPPGLEYCYNPSHNPEEQLSSKDL
VSCAYQVARGMEYLASKKCIHRDLAARNVLVTEDNVMKIADFGLARDIHHIDYYKKTTNG
RLPVKWMAPEALFDRIYTHQSDVWSFGVLLWEIFTLGGSPYPGVPVEELFKLLKEGHRMD
KPSNCTNELYMMMRDCWHAVPSQRPTFKQLVEDL
DRIVALTSNQEYLDLSMPLDQYSPSF
PDTRSSTCSSGEDSVFSHEPLPEEPCLPRHPAQLANGGLKRR
Sequence length 822
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  MAPK signaling pathway
Ras signaling pathway
Rap1 signaling pathway
Calcium signaling pathway
PI3K-Akt signaling pathway
Adherens junction
Signaling pathways regulating pluripotency of stem cells
Thermogenesis
Regulation of actin cytoskeleton
Parathyroid hormone synthesis, secretion and action
Pathways in cancer
Proteoglycans in cancer
Prostate cancer
Melanoma
Breast cancer
Central carbon metabolism in cancer
  PI3K Cascade
PIP3 activates AKT signaling
Signaling by FGFR1 amplification mutants
Signaling by activated point mutants of FGFR1
FGFR1b ligand binding and activation
FGFR1c ligand binding and activation
FGFR1c and Klotho ligand binding and activation
Constitutive Signaling by Aberrant PI3K in Cancer
Signal transduction by L1
Phospholipase C-mediated cascade: FGFR1
Downstream signaling of activated FGFR1
SHC-mediated cascade:FGFR1
PI-3K cascade:FGFR1
FRS-mediated FGFR1 signaling
Negative regulation of FGFR1 signaling
Signaling by FGFR1 in disease
RAF/MAP kinase cascade
PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling
Signaling by plasma membrane FGFR1 fusions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
110
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession Evidence Score
Cerebellar vermis hypoplasia Likely pathogenic; Pathogenic rs1563436265 RCV000779636
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Congenital cerebellar hypoplasia Likely pathogenic; Pathogenic rs1563436265 RCV001257986
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Delayed puberty Likely pathogenic; Pathogenic rs727505370, rs727505371, rs727505373, rs121909628, rs121909636 RCV000156956
RCV000156958
RCV000156962
RCV000156954
RCV000156950
★★★★★
ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Diffuse midline glioma, H3 K27M-mutant Pathogenic rs779707422, rs869320694 RCV006253899
RCV006253907
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
Amenorrhea Uncertain significance ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
ANOREXIA NERVOSA GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
ASTROCYTOMA CTD
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
ATTENTION DEFICIT HYPERACTIVITY DISORDER GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
2-3 toe syndactyly Syndactyly Of The Toes HPO_DG
★☆☆☆☆
Found in Text Mining only
Absence of septum pellucidum Absence Of Septum Pellucidum HPO_DG
★☆☆☆☆
Found in Text Mining only
Acanthosis Nigricans Acanthosis Nigricans BEFREE 14987407
★☆☆☆☆
Found in Text Mining only
Acquired porencephaly Acquired Porencephaly HPO_DG
★☆☆☆☆
Found in Text Mining only
Acrocephaly Acrocephaly CTD_human_DG
★☆☆☆☆
Found in Text Mining only
Acute leukemia Leukemia BEFREE 20554971, 23171834, 29119847
★☆☆☆☆
Found in Text Mining only
Acute lymphoblastic leukemia with lymphomatous features Lymphoblastic Leukemia With Lymphomatous Features CLINVAR_DG 26619011
★☆☆☆☆
Found in Text Mining only
Acute lymphocytic leukemia Lymphocytic Leukemia BEFREE 21810092, 23609419, 28551329, 29735550
★☆☆☆☆
Found in Text Mining only
Acute Megakaryocytic Leukemias Megakaryocytic Leukemia BEFREE 1311927
★☆☆☆☆
Found in Text Mining only
Acute monocytic leukemia Monocytic Leukemia BEFREE 17394134, 27005999
★☆☆☆☆
Found in Text Mining only