FGF14 (fibroblast growth factor 14)

Gene

• Entrez ID: 2259
• Gene name: Fibroblast growth factor 14
• Gene symbol: FGF14
• Synonyms (NCBI Gene): FGF-14, FHF-4, FHF4, NYS4, SCA27, SCA27A, SCA27B
• Chromosome: 13
• Chromosome location: 13q33.1
• Summary: The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cel

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs104894393	A>G	Pathogenic	Genic downstream transcript variant, missense variant, coding sequence variant
rs587776685	T>-	Pathogenic	Genic downstream transcript variant, frameshift variant, coding sequence variant
rs1555370787	T>A	Pathogenic	Stop gained, genic downstream transcript variant, coding sequence variant
rs1566823361	->G	Likely-pathogenic	Genic downstream transcript variant, coding sequence variant, frameshift variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT608846	hsa-miR-511-3p	HITS-CLIP	21572407
MIRT608845	hsa-miR-223-5p	HITS-CLIP	21572407
MIRT608844	hsa-miR-6867-5p	HITS-CLIP	21572407
MIRT608843	hsa-miR-4455	HITS-CLIP	21572407
MIRT608842	hsa-miR-574-5p	HITS-CLIP	21572407
MIRT608846	hsa-miR-511-3p	HITS-CLIP	23313552
MIRT608845	hsa-miR-223-5p	HITS-CLIP	23313552
MIRT608844	hsa-miR-6867-5p	HITS-CLIP	23313552
MIRT684225	hsa-miR-8068	HITS-CLIP	23313552
MIRT684224	hsa-miR-6818-5p	HITS-CLIP	23313552
MIRT684223	hsa-miR-147a	HITS-CLIP	23313552
MIRT684222	hsa-miR-5010-3p	HITS-CLIP	23313552
MIRT608843	hsa-miR-4455	HITS-CLIP	23313552
MIRT608842	hsa-miR-574-5p	HITS-CLIP	23313552
MIRT608846	hsa-miR-511-3p	HITS-CLIP	24906430
MIRT608845	hsa-miR-223-5p	HITS-CLIP	24906430
MIRT608844	hsa-miR-6867-5p	HITS-CLIP	24906430
MIRT608843	hsa-miR-4455	HITS-CLIP	24906430
MIRT608842	hsa-miR-574-5p	HITS-CLIP	24906430
MIRT608845	hsa-miR-223-5p	HITS-CLIP	27418678
MIRT608843	hsa-miR-4455	HITS-CLIP	27418678
MIRT608846	hsa-miR-511-3p	HITS-CLIP	27418678
MIRT608842	hsa-miR-574-5p	HITS-CLIP	27418678
MIRT608844	hsa-miR-6867-5p	HITS-CLIP	27418678
MIRT608846	hsa-miR-511-3p	HITS-CLIP	21572407
MIRT608845	hsa-miR-223-5p	HITS-CLIP	21572407
MIRT608844	hsa-miR-6867-5p	HITS-CLIP	21572407
MIRT608843	hsa-miR-4455	HITS-CLIP	21572407
MIRT608842	hsa-miR-574-5p	HITS-CLIP	21572407
MIRT608846	hsa-miR-511-3p	HITS-CLIP	23313552
MIRT608845	hsa-miR-223-5p	HITS-CLIP	23313552
MIRT608844	hsa-miR-6867-5p	HITS-CLIP	23313552
MIRT684225	hsa-miR-8068	HITS-CLIP	23313552
MIRT684224	hsa-miR-6818-5p	HITS-CLIP	23313552
MIRT684223	hsa-miR-147a	HITS-CLIP	23313552
MIRT684222	hsa-miR-5010-3p	HITS-CLIP	23313552
MIRT608843	hsa-miR-4455	HITS-CLIP	23313552
MIRT608842	hsa-miR-574-5p	HITS-CLIP	23313552
MIRT995579	hsa-miR-3185	CLIP-seq
MIRT995580	hsa-miR-3607-3p	CLIP-seq
MIRT995581	hsa-miR-3934	CLIP-seq
MIRT995582	hsa-miR-4292	CLIP-seq
MIRT995583	hsa-miR-4308	CLIP-seq
MIRT995584	hsa-miR-4703-3p	CLIP-seq
MIRT995585	hsa-miR-4711-3p	CLIP-seq
MIRT995586	hsa-miR-4747-5p	CLIP-seq
MIRT995587	hsa-miR-4778-3p	CLIP-seq
MIRT995588	hsa-miR-495	CLIP-seq
MIRT995589	hsa-miR-511	CLIP-seq
MIRT995590	hsa-miR-513a-3p	CLIP-seq
MIRT995591	hsa-miR-539	CLIP-seq
MIRT995592	hsa-miR-548c-3p	CLIP-seq
MIRT995593	hsa-miR-578	CLIP-seq
MIRT995594	hsa-miR-670	CLIP-seq
MIRT1995227	hsa-miR-3591-3p	CLIP-seq
MIRT1995228	hsa-miR-4691-3p	CLIP-seq
MIRT1995229	hsa-miR-616	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005104	Function	Fibroblast growth factor receptor binding	IDA	12815063
GO:0005515	Function	Protein binding	IPI	22364545, 25659151, 26900580, 32296183, 32814053
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0007165	Process	Signal transduction	TAS	8790420
GO:0007254	Process	JNK cascade	IPI	12815063
GO:0007267	Process	Cell-cell signaling	IEA
GO:0007267	Process	Cell-cell signaling	TAS	8790420
GO:0007399	Process	Nervous system development	IEA
GO:0007399	Process	Nervous system development	TAS	8790420
GO:0008083	Function	Growth factor activity	IEA
GO:0008083	Function	Growth factor activity	TAS	8790420
GO:0008201	Function	Heparin binding	IDA	12815063
GO:0008543	Process	Fibroblast growth factor receptor signaling pathway	IDA	12815063
GO:0017080	Function	Sodium channel regulator activity	IBA
GO:0022008	Process	Neurogenesis	IBA

Other IDs

• MIM: 601515
• HGNC: 3671
• e!Ensembl: ENSG00000102466

Protein

• UniProt ID: Q92915
• Protein name: Fibroblast growth factor 14 (FGF-14) (Fibroblast growth factor homologous factor 4) (FHF-4)
• Protein function: Probably involved in nervous system development and function.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00167	FGF	71 → 197	Fibroblast growth factor	Domain

• Tissue specificity: TISSUE SPECIFICITY: Nervous system.
• Sequence:

  MAAAIASGLIRQKRQAREQHWDRPSASRRRSSPSKNRGLCNGNLVDIFSKVRIFGLKKRR
  LRRQDPQLKGIVTRLYCRQGYYLQMHPDGALDGTKDDSTNSTLFNLIPVGLRVVAIQGVK
  TGLYIAMNGEGYLYPSELFTPECKFKESVFENYYVIYSSMLYRQQESGRAWFLGLNKEGQ
  AMKGNRVKKTKPAAHFLPKPLEVAMYREPSLHDVGETVPKPGVTPSKSTSASAIMNGGKP
  VNKSKTT

• Sequence length: 247

Pathways

KEGG:

Spinocerebellar ataxia

Reactome:

Phase 0 - rapid depolarisation

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Cerebellar ataxia	Pathogenic	rs2047659273	RCV002508353	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
FGF14-related disorder	Likely pathogenic	rs2501856727	RCV003408225	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Spinocerebellar ataxia 27A	Pathogenic; Likely pathogenic	rs865878627, rs2501931660, rs104894393, rs587776685, rs2548901390, rs2501931899, rs1555370787	RCV002291320 RCV002291254 RCV002472354 RCV002472355 RCV003984960 RCV003988712 RCV002472357	★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Spinocerebellar ataxia 27B, late-onset	Pathogenic	rs2047659273	RCV003128119	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Spinocerebellar ataxia type 27	Likely pathogenic; Pathogenic	rs2501856727, rs1555370787	RCV002308564 RCV000580889	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ATAXIA, SPINOCEREBELLAR	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATRIAL FIBRILLATION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autosomal dominant cerebellar ataxia	Uncertain significance; Likely benign; Benign; Conflicting classifications of pathogenicity	ClinVar Disgenet	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
AUTOSOMAL RECESSIVE CEREBELLAR ATAXIA	—	Disgenet, GenCC Disgenet, GenCC	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARTILAGE DISEASES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COGNITION DISORDERS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DELIRIUM, DEMENTIA, AMNESTIC, COGNITIVE DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PREECLAMPSIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSYCHIATRIC DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SPINOCEREBELLAR ATAXIA 27	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SPINOCEREBELLAR ATAXIA TYPE 27A	—	Orphanet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SPINOCEREBELLAR ATAXIA TYPE 27B	—	Disgenet, Orphanet Disgenet, Orphanet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UPPER AERODIGESTIVE TRACT NEOPLASM	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VENOUS THROMBOEMBOLISM	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Akinesia	Akinesia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Amnesia	Amnesia	BEFREE	28522250		★☆☆☆☆ Found in Text Mining only
Ataxia	Ataxia	Pubtator	16166153, 36207621, 36493768, 37322040, 37460234, 37916889, 38150853, 38487929, 40156335, 40191983	Associate	★☆☆☆☆ Found in Text Mining only
Ataxia Sensory Autosomal Dominant	Ataxia, sensory, autosomal dominant	Pubtator	40156335	Associate	★☆☆☆☆ Found in Text Mining only
Ataxia, Spinocerebellar	Spinocerebellar Ataxia	LHGDN	15365159, 16211615		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ataxia, Spinocerebellar	Spinocerebellar Ataxia	BEFREE	16211615, 19621416, 21600715		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autistic Disorder	Autism	Pubtator	32717741	Associate	★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	37460234	Associate	★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases of the Nervous System	Autoimmune nervous system disorder	Pubtator	37460234	Associate	★☆☆☆☆ Found in Text Mining only
Autonomic Nervous System Diseases	Autonomic nervous system disease	Pubtator	36493768	Associate	★☆☆☆☆ Found in Text Mining only
Brain Diseases	Brain disease	Pubtator	37460234	Associate	★☆☆☆☆ Found in Text Mining only
Brain Stem Neoplasms	Brain stem neoplasms	Pubtator	37460234	Associate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	36216883	Associate	★☆☆☆☆ Found in Text Mining only
Brugada Syndrome (disorder)	Brugada Syndrome	BEFREE	24096171		★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	Pubtator	31467233	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	34783177	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	34061869	Associate	★☆☆☆☆ Found in Text Mining only
Cartilage Diseases	Cartilage Diseases	CTD_human_DG	11241832		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cerebellar Ataxia	Cerebellar ataxia	Pubtator	36493768, 36516086, 37916889, 38150853, 38487929, 40556471, 40579842	Associate	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Cerebellar atrophy	Cerebellar atrophy	HPO_DG			★☆☆☆☆ Found in Text Mining only
Chondromalacia	Chondromalacia	CTD_human_DG	11241832		★☆☆☆☆ Found in Text Mining only
Chronic lung disease	Lung Diseases	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	16166153	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cognition Disorders	Cognitive disorder	BEFREE	19471976		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cognition Disorders	Cognitive disorder	CTD_human_DG	26089778		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Color Blindness, Red-Green	Color blindness	HPO_DG			★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	32654025	Inhibit	★☆☆☆☆ Found in Text Mining only
Common Variable Immunodeficiency	Common Variable Immunodeficiency	GWASDB_DG	21497890		★☆☆☆☆ Found in Text Mining only
Congenital pectus carinatum	Congenital Pectus Carinatum	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Craniosynostosis	Craniosynostosis	BEFREE	26149656		★☆☆☆☆ Found in Text Mining only
Cryptorchidism	Cryptorchidism	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Dentatorubral-Pallidoluysian Atrophy	Dentatorubral Pallidoluysian Atrophy	BEFREE	20641168		★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	HPO_DG			★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	30825225		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	GWASCAT_DG	28736931		★☆☆☆☆ Found in Text Mining only
Dysarthria	Dysarthria	Pubtator	37460234, 40191983	Associate	★☆☆☆☆ Found in Text Mining only
Dysarthria	Dysarthria	HPO_DG			★☆☆☆☆ Found in Text Mining only
Dysgraphia	Dysgraphia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Dyskinesias, Paroxysmal	Dyskinesia	BEFREE	12489043, 19471976		★☆☆☆☆ Found in Text Mining only
Dyskinetic syndrome	Dyskinetic Syndrome	BEFREE	15895552, 21600715		★☆☆☆☆ Found in Text Mining only
Episodic Ataxia	Episodic Ataxia	BEFREE	25566820, 30607796		★☆☆☆☆ Found in Text Mining only
Episodic Ataxia	Episodic ataxia	Pubtator	32162847, 36207621	Associate	★☆☆☆☆ Found in Text Mining only
Episodic Ataxia Type 2	Episodic ataxia	Pubtator	32162847	Associate	★☆☆☆☆ Found in Text Mining only
Familial Hypophosphatemic Rickets	Hypophosphatemic Rickets	BEFREE	19621416		★☆☆☆☆ Found in Text Mining only
Foramen Ovale, Patent	Patent foramen ovale	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Glycogen Storage Disease Type II	Glycogen storage disease	Pubtator	37322040, 37916889, 40579842	Associate	★☆☆☆☆ Found in Text Mining only
Growth Disorders	Growth disorder	Pubtator	26483173	Associate	★☆☆☆☆ Found in Text Mining only
Hyperopia	Hyperopia	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Hypophosphatemic Rickets	Hypophosphatemic Rickets	BEFREE	19621416		★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	19471976		★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Infertility Male	Male infertility	Pubtator	34204705	Associate	★☆☆☆☆ Found in Text Mining only
Intervertebral disc disorder	Intervertebral Disc Disorder	BEFREE	30825225		★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal disease	Pubtator	17071588	Associate	★☆☆☆☆ Found in Text Mining only
Learning Disabilities	Learning disorders	Pubtator	32162847	Associate	★☆☆☆☆ Found in Text Mining only
Lingual-Facial-Buccal Dyskinesia	Orofacial dyskinesia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	38040694	Associate	★☆☆☆☆ Found in Text Mining only
Mental disorders	Mental Disorders	BEFREE	30189289		★☆☆☆☆ Found in Text Mining only
Mild Mental Retardation	Mental retardation	HPO_DG			★☆☆☆☆ Found in Text Mining only
Mixed anxiety and depressive disorder	Mixed Anxiety And Depressive Disorder	BEFREE	28469558		★☆☆☆☆ Found in Text Mining only
Movement Disorders	Movement Disorders	BEFREE	16211615		★☆☆☆☆ Found in Text Mining only
Multiple System Atrophy	Multiple system atrophy	Pubtator	37916889	Associate	★☆☆☆☆ Found in Text Mining only
Nervous System Diseases	Nervous system disease	Pubtator	38487929, 40579842	Associate	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	37460234	Associate	★☆☆☆☆ Found in Text Mining only
Nystagmus Pathologic	Nystagmus	Pubtator	12525540, 32157568, 32162847, 36207621, 38381176, 40191983, 40556471	Associate	★☆☆☆☆ Found in Text Mining only
Nystagmus, End-Position	Nystagmus	HPO_DG			★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	32862604	Inhibit	★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	34061869	Associate	★☆☆☆☆ Found in Text Mining only
Parkinson Disease Secondary	Secondary parkinson disease	Pubtator	37916889	Associate	★☆☆☆☆ Found in Text Mining only
Peripheral Nervous System Diseases	Nervous System Diseases	BEFREE	15895552		★☆☆☆☆ Found in Text Mining only
Peripheral Neuropathy	Peripheral Neuropathy	BEFREE	15895552		★☆☆☆☆ Found in Text Mining only
Pituitary Neoplasms	Pituitary neoplasm	Pubtator	36750863	Associate	★☆☆☆☆ Found in Text Mining only
Progressive cerebellar ataxia	Cerebellar Ataxia	BEFREE	12489043		★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	37466093	Associate	★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	28469558		★☆☆☆☆ Found in Text Mining only
Scoliosis, unspecified	Scoliosis	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Septic Toxemia	Septic Toxemia	GWASCAT_DG	23551011		★☆☆☆☆ Found in Text Mining only
SPINOCEREBELLAR ATAXIA 27	Spinocerebellar Ataxia	UNIPROT_DG	12489043		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SPINOCEREBELLAR ATAXIA 27	Spinocerebellar Ataxia	GENOMICS_ENGLAND_DG	15470364, 16211615		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SPINOCEREBELLAR ATAXIA 27	Spinocerebellar Ataxia	BEFREE	22579694, 24252256, 25566820, 30017992, 31729429		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SPINOCEREBELLAR ATAXIA 27	Spinocerebellar Ataxia	CTD_human_DG	26089778		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Spinocerebellar ataxia 27	Spinocerebellar ataxia	Pubtator	36207621, 37460234	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SPINOCEREBELLAR ATAXIA 27	Spinocerebellar Ataxia	CLINVAR_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SPINOCEREBELLAR ATAXIA 27	Spinocerebellar Ataxia	ORPHANET_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Spinocerebellar ataxia type 27	Spinocerebellar Ataxia	Orphanet			★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Spinocerebellar Ataxias	Spinocerebellar ataxia	Pubtator	37322040, 37907039, 39392764, 40191983, 40556471, 40579842	Associate	★☆☆☆☆ Found in Text Mining only
Strabismus	Strabismus	HPO_DG			★☆☆☆☆ Found in Text Mining only
Talipes valgus	Talipes valgus	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Tremor	Tremor	Pubtator	32162847, 37460234, 38487929, 40156335	Associate	★☆☆☆☆ Found in Text Mining only
Uranostaphyloschisis	Uranostaphyloschisis	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Vestibular Diseases	Vestibular disease	Pubtator	36493768	Associate	★☆☆☆☆ Found in Text Mining only