Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	2256
Gene name	Fibroblast growth factor 11
Gene symbol	FGF11
Synonyms (NCBI Gene)	FGF-11FHF-3FHF3
Chromosome	17
Chromosome location	17p13.1
Summary	The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cel

110

Show/Hide all (110)

miRTarBase ID	miRNA	Experiments	Reference
MIRT018154	hsa-miR-335-5p	Microarray	18185580
MIRT041432	hsa-miR-193b-3p	CLASH	23622248
MIRT040846	hsa-miR-18a-3p	CLASH	23622248
MIRT995499	hsa-miR-1262	CLIP-seq
MIRT995500	hsa-miR-1293	CLIP-seq
MIRT995501	hsa-miR-4259	CLIP-seq
MIRT995502	hsa-miR-4433	CLIP-seq
MIRT995503	hsa-miR-4483	CLIP-seq
MIRT995504	hsa-miR-4519	CLIP-seq
MIRT995505	hsa-miR-4701-3p	CLIP-seq
MIRT995506	hsa-miR-4755-3p	CLIP-seq
MIRT995507	hsa-miR-571	CLIP-seq
MIRT995508	hsa-miR-665	CLIP-seq
MIRT1995190	hsa-miR-1233	CLIP-seq
MIRT995499	hsa-miR-1262	CLIP-seq
MIRT995500	hsa-miR-1293	CLIP-seq
MIRT1995191	hsa-miR-130a	CLIP-seq
MIRT1995192	hsa-miR-130b	CLIP-seq
MIRT1995193	hsa-miR-198	CLIP-seq
MIRT1995194	hsa-miR-301a	CLIP-seq
MIRT1995195	hsa-miR-301b	CLIP-seq
MIRT1995196	hsa-miR-3154	CLIP-seq
MIRT1995197	hsa-miR-331-5p	CLIP-seq
MIRT1995198	hsa-miR-338-3p	CLIP-seq
MIRT1995199	hsa-miR-34c-3p	CLIP-seq
MIRT1995200	hsa-miR-3609	CLIP-seq
MIRT1995201	hsa-miR-3657	CLIP-seq
MIRT1995202	hsa-miR-3661	CLIP-seq
MIRT1995203	hsa-miR-3666	CLIP-seq
MIRT1995204	hsa-miR-3691-3p	CLIP-seq
MIRT1995205	hsa-miR-3927	CLIP-seq
MIRT995501	hsa-miR-4259	CLIP-seq
MIRT1995206	hsa-miR-4295	CLIP-seq
MIRT1995207	hsa-miR-4312	CLIP-seq
MIRT1995208	hsa-miR-4313	CLIP-seq
MIRT1995209	hsa-miR-432	CLIP-seq
MIRT995502	hsa-miR-4433	CLIP-seq
MIRT995503	hsa-miR-4483	CLIP-seq
MIRT995504	hsa-miR-4519	CLIP-seq
MIRT1995210	hsa-miR-4530	CLIP-seq
MIRT1995211	hsa-miR-454	CLIP-seq
MIRT1995212	hsa-miR-4650-3p	CLIP-seq
MIRT1995213	hsa-miR-4669	CLIP-seq
MIRT1995214	hsa-miR-4671-3p	CLIP-seq
MIRT1995215	hsa-miR-4678	CLIP-seq
MIRT995505	hsa-miR-4701-3p	CLIP-seq
MIRT995506	hsa-miR-4755-3p	CLIP-seq
MIRT1995216	hsa-miR-548ah	CLIP-seq
MIRT1995217	hsa-miR-548t	CLIP-seq
MIRT995507	hsa-miR-571	CLIP-seq
MIRT1995218	hsa-miR-631	CLIP-seq
MIRT1995219	hsa-miR-657	CLIP-seq
MIRT995508	hsa-miR-665	CLIP-seq
MIRT2229299	hsa-miR-103a	CLIP-seq
MIRT2229300	hsa-miR-107	CLIP-seq
MIRT2229301	hsa-miR-1254	CLIP-seq
MIRT995499	hsa-miR-1262	CLIP-seq
MIRT995500	hsa-miR-1293	CLIP-seq
MIRT1995193	hsa-miR-198	CLIP-seq
MIRT2229302	hsa-miR-3116	CLIP-seq
MIRT1995196	hsa-miR-3154	CLIP-seq
MIRT2229303	hsa-miR-3192	CLIP-seq
MIRT1995198	hsa-miR-338-3p	CLIP-seq
MIRT2229304	hsa-miR-361-3p	CLIP-seq
MIRT1995201	hsa-miR-3657	CLIP-seq
MIRT1995205	hsa-miR-3927	CLIP-seq
MIRT995501	hsa-miR-4259	CLIP-seq
MIRT995502	hsa-miR-4433	CLIP-seq
MIRT995503	hsa-miR-4483	CLIP-seq
MIRT995504	hsa-miR-4519	CLIP-seq
MIRT1995210	hsa-miR-4530	CLIP-seq
MIRT1995212	hsa-miR-4650-3p	CLIP-seq
MIRT1995213	hsa-miR-4669	CLIP-seq
MIRT995505	hsa-miR-4701-3p	CLIP-seq
MIRT995506	hsa-miR-4755-3p	CLIP-seq
MIRT2229305	hsa-miR-4775	CLIP-seq
MIRT995507	hsa-miR-571	CLIP-seq
MIRT2229306	hsa-miR-590-3p	CLIP-seq
MIRT2229307	hsa-miR-661	CLIP-seq
MIRT995508	hsa-miR-665	CLIP-seq
MIRT2229308	hsa-miR-885-3p	CLIP-seq
MIRT995499	hsa-miR-1262	CLIP-seq
MIRT995500	hsa-miR-1293	CLIP-seq
MIRT995501	hsa-miR-4259	CLIP-seq
MIRT995502	hsa-miR-4433	CLIP-seq
MIRT995503	hsa-miR-4483	CLIP-seq
MIRT995504	hsa-miR-4519	CLIP-seq
MIRT995505	hsa-miR-4701-3p	CLIP-seq
MIRT995506	hsa-miR-4755-3p	CLIP-seq
MIRT995507	hsa-miR-571	CLIP-seq
MIRT995508	hsa-miR-665	CLIP-seq
MIRT2229299	hsa-miR-103a	CLIP-seq
MIRT2229300	hsa-miR-107	CLIP-seq
MIRT2532832	hsa-miR-137	CLIP-seq
MIRT2532833	hsa-miR-219-2-3p	CLIP-seq
MIRT2532834	hsa-miR-2964a-3p	CLIP-seq
MIRT2532835	hsa-miR-3170	CLIP-seq
MIRT2229303	hsa-miR-3192	CLIP-seq
MIRT2532836	hsa-miR-3672	CLIP-seq
MIRT2532837	hsa-miR-3689a-3p	CLIP-seq
MIRT2532838	hsa-miR-3689c	CLIP-seq
MIRT2532839	hsa-miR-3919	CLIP-seq
MIRT2532840	hsa-miR-4279	CLIP-seq
MIRT2532841	hsa-miR-4680-3p	CLIP-seq
MIRT2532842	hsa-miR-4728-5p	CLIP-seq
MIRT2532843	hsa-miR-520a-5p	CLIP-seq
MIRT2532844	hsa-miR-525-5p	CLIP-seq
MIRT2532845	hsa-miR-615-5p	CLIP-seq
MIRT2532846	hsa-miR-628-5p	CLIP-seq
MIRT2229308	hsa-miR-885-3p	CLIP-seq

Show/Hide all (12)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005634	Component	Nucleus	IBA
GO:0005737	Component	Cytoplasm	IBA
GO:0007165	Process	Signal transduction	TAS	8790420
GO:0007267	Process	Cell-cell signaling	IEA
GO:0007267	Process	Cell-cell signaling	TAS	8790420
GO:0007399	Process	Nervous system development	IEA
GO:0007399	Process	Nervous system development	TAS	8790420
GO:0008083	Function	Growth factor activity	IEA
GO:0008083	Function	Growth factor activity	TAS	8790420
GO:0017080	Function	Sodium channel regulator activity	IBA
GO:0022008	Process	Neurogenesis	IBA

MIM	HGNC	e!Ensembl
601514	3667	ENSG00000161958

Q92914

Protein name

Fibroblast growth factor 11 (FGF-11) (Fibroblast growth factor homologous factor 3) (FHF-3)

Protein function

Probably involved in nervous system development and function.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00167	FGF	71 → 197	Fibroblast growth factor	Domain

Tissue specificity

TISSUE SPECIFICITY: Nervous system.

Sequence

MAALASSLIRQKREVREPGGSRPVSAQRRVCPRGTKSLCQKQLLILLSKVRLCGGRPARP
DRGPEPQLKGIVTKLFCRQGFYLQANPDGSIQGTPEDTSSFTHFNLIPVGLRVVTIQSAK
LGHYMAMNAEGLLYSSPHFTAECRFKECVFENYYVLYASALYRQRRSGRAWYLGLDKEGQ
VMKGNRVKKTKAAAHFLPKLLEVAMYQEPSLHSVPEASPSSPPAP

Sequence length

225

Interactions

View interactions

	Reactome
			Phase 0 - rapid depolarisation

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (6)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ANDROGENETIC ALOPECIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOYAMOYA DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Papillary renal cell carcinoma type 1	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (18)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Aortic Valve Insufficiency	Aortic Valve Insufficiency	BEFREE	25135278		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bone Resorption	Bone resorption	Pubtator	28097375	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brugada Syndrome (disorder)	Brugada Syndrome	BEFREE	24096171		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	40334645	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	29852165		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	31680239		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dupuytren Contracture	Dupuytren contracture	Pubtator	23554969	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Giant Cell Tumor of Bone	Giant cell tumor of bone	BEFREE	28097375		★★★★★ ★☆☆☆☆ Found in Text Mining only
Giant Cell Tumor of Bone	Giant cell tumor of bone	Pubtator	28097375	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	BEFREE	29852165		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	28097375	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	34404435	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure Chronic	Kidney failure	Pubtator	40334645	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	25135278		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	27538493		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	27538493		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	25135278		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	34315402	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

FGF11 (fibroblast growth factor 11)