FGF2 (fibroblast growth factor 2)

Gene

• Entrez ID: 2247
• Gene name: Fibroblast growth factor 2
• Gene symbol: FGF2
• Synonyms (NCBI Gene): BFGF, FGF-2, FGFB, HBGF-2
• Chromosome: 4
• Chromosome location: 4q28.1
• Summary: The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members bind heparin and possess broad mitogenic and angiogenic activities. This protein has been implicated in diverse biological processes, such as lim

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT000736	hsa-miR-199a-5p	Review	19574400
MIRT000733	hsa-miR-145-5p	Review	19574400
MIRT001468	hsa-miR-16-5p	pSILAC	18668040
MIRT003962	hsa-miR-140-5p	Microarray	17875710
MIRT007223	hsa-miR-503-5p	Luciferase reporter assay	23352645
MIRT007223	hsa-miR-503-5p	Luciferase reporter assay	23352645
MIRT020683	hsa-miR-155-5p	Proteomics	18668040
MIRT021161	hsa-miR-186-5p	Sequencing	20371350
MIRT024732	hsa-miR-215-5p	Microarray	19074876
MIRT026446	hsa-miR-192-5p	Microarray	19074876
MIRT027141	hsa-miR-103a-3p	Sequencing	20371350
MIRT028310	hsa-miR-32-5p	Sequencing	20371350
MIRT001468	hsa-miR-16-5p	Sequencing	20371350
MIRT001468	hsa-miR-16-5p	Proteomics;Other	18668040
MIRT049684	hsa-miR-92a-3p	CLASH	23622248
MIRT054815	hsa-miR-15b-5p	qRT-PCR	24560946
MIRT211201	hsa-miR-424-5p	Immunohistochemistry, Luciferase reporter assay, Microarray, Northern blot, qRT-PCR	23263626
MIRT007223	hsa-miR-503-5p	Immunohistochemistry, Luciferase reporter assay, Microarray, Northern blot, qRT-PCR	23263626
MIRT438378	hsa-miR-152-3p	Luciferase reporter assay, Western blot	25190353
MIRT438378	hsa-miR-152-3p	Luciferase reporter assay, Western blot	25190353
MIRT438378	hsa-miR-152-3p	Luciferase reporter assay, Western blot	25190353
MIRT438378	hsa-miR-152-3p	Luciferase reporter assay, Western blot	25190353
MIRT724422	hsa-miR-3653-5p	HITS-CLIP	19536157
MIRT724421	hsa-miR-1976	HITS-CLIP	19536157
MIRT724420	hsa-miR-3671	HITS-CLIP	19536157
MIRT724419	hsa-miR-607	HITS-CLIP	19536157
MIRT724418	hsa-miR-1305	HITS-CLIP	19536157
MIRT211231	hsa-miR-548c-3p	HITS-CLIP	21572407
MIRT211229	hsa-miR-495-3p	HITS-CLIP	21572407
MIRT211232	hsa-miR-5688	HITS-CLIP	21572407
MIRT211225	hsa-miR-7-1-3p	HITS-CLIP	21572407
MIRT211226	hsa-miR-7-2-3p	HITS-CLIP	21572407
MIRT476871	hsa-miR-5003-3p	HITS-CLIP	21572407
MIRT211223	hsa-miR-25-3p	HITS-CLIP	21572407
MIRT028310	hsa-miR-32-5p	HITS-CLIP	21572407
MIRT211227	hsa-miR-363-3p	HITS-CLIP	21572407
MIRT211228	hsa-miR-367-3p	HITS-CLIP	21572407
MIRT049684	hsa-miR-92a-3p	HITS-CLIP	21572407
MIRT211230	hsa-miR-92b-3p	HITS-CLIP	21572407
MIRT476870	hsa-miR-759	HITS-CLIP	21572407
MIRT476869	hsa-miR-5589-3p	HITS-CLIP	21572407
MIRT557867	hsa-miR-199b-3p	HITS-CLIP	21572407
MIRT557866	hsa-miR-199a-3p	HITS-CLIP	21572407
MIRT557865	hsa-miR-3129-5p	HITS-CLIP	21572407
MIRT507255	hsa-miR-708-3p	HITS-CLIP	21572407
MIRT211261	hsa-miR-548p	HITS-CLIP	21572407
MIRT211264	hsa-miR-6504-3p	HITS-CLIP	21572407
MIRT211257	hsa-miR-545-3p	HITS-CLIP	21572407
MIRT309159	hsa-miR-936	HITS-CLIP	21572407
MIRT557864	hsa-miR-26b-3p	HITS-CLIP	21572407
MIRT211258	hsa-miR-1468-3p	HITS-CLIP	21572407
MIRT537379	hsa-miR-1206	HITS-CLIP	21572407
MIRT537378	hsa-miR-6853-3p	HITS-CLIP	21572407
MIRT309153	hsa-miR-222-5p	HITS-CLIP	21572407
MIRT537377	hsa-miR-376a-3p	HITS-CLIP	21572407
MIRT537376	hsa-miR-376b-3p	HITS-CLIP	21572407
MIRT001468	hsa-miR-16-5p	PAR-CLIP	20371350
MIRT211201	hsa-miR-424-5p	PAR-CLIP	20371350
MIRT211210	hsa-miR-6838-5p	PAR-CLIP	20371350
MIRT211199	hsa-miR-15a-5p	PAR-CLIP	20371350
MIRT211200	hsa-miR-195-5p	PAR-CLIP	20371350
MIRT054815	hsa-miR-15b-5p	PAR-CLIP	20371350
MIRT211203	hsa-miR-497-5p	PAR-CLIP	20371350
MIRT211204	hsa-miR-1276	PAR-CLIP	20371350
MIRT211205	hsa-miR-2278	PAR-CLIP	20371350
MIRT211209	hsa-miR-451b	PAR-CLIP	20371350
MIRT211208	hsa-miR-4670-3p	PAR-CLIP	20371350
MIRT211206	hsa-miR-3148	PAR-CLIP	20371350
MIRT211207	hsa-miR-4668-5p	PAR-CLIP	20371350
MIRT574775	hsa-miR-3153	PAR-CLIP	20371350
MIRT574774	hsa-miR-6733-5p	PAR-CLIP	20371350
MIRT574773	hsa-miR-6739-5p	PAR-CLIP	20371350
MIRT211202	hsa-miR-450a-1-3p	PAR-CLIP	20371350
MIRT574772	hsa-miR-3122	PAR-CLIP	20371350
MIRT574771	hsa-miR-3913-5p	PAR-CLIP	20371350
MIRT574770	hsa-miR-887-5p	PAR-CLIP	20371350
MIRT574769	hsa-miR-6513-5p	PAR-CLIP	20371350
MIRT507255	hsa-miR-708-3p	PAR-CLIP	20371350
MIRT211261	hsa-miR-548p	PAR-CLIP	20371350
MIRT211264	hsa-miR-6504-3p	PAR-CLIP	20371350
MIRT211257	hsa-miR-545-3p	PAR-CLIP	20371350
MIRT211258	hsa-miR-1468-3p	PAR-CLIP	20371350
MIRT007223	hsa-miR-503-5p	PAR-CLIP	20371350
MIRT211195	hsa-miR-562	PAR-CLIP	20371350
MIRT548232	hsa-miR-6074	PAR-CLIP	20371350
MIRT309162	hsa-miR-892c-5p	PAR-CLIP	20371350
MIRT309156	hsa-miR-506-5p	PAR-CLIP	20371350
MIRT211198	hsa-miR-5697	PAR-CLIP	20371350
MIRT507259	hsa-miR-4310	PAR-CLIP	20371350
MIRT507258	hsa-miR-7157-5p	PAR-CLIP	20371350
MIRT507257	hsa-miR-3691-3p	PAR-CLIP	20371350
MIRT309161	hsa-miR-5695	PAR-CLIP	20371350
MIRT211196	hsa-miR-4524a-5p	PAR-CLIP	20371350
MIRT211197	hsa-miR-4524b-5p	PAR-CLIP	20371350
MIRT507256	hsa-miR-4291	PAR-CLIP	20371350
MIRT211231	hsa-miR-548c-3p	PAR-CLIP	20371350
MIRT211229	hsa-miR-495-3p	PAR-CLIP	20371350
MIRT211232	hsa-miR-5688	PAR-CLIP	20371350
MIRT211225	hsa-miR-7-1-3p	PAR-CLIP	20371350
MIRT211226	hsa-miR-7-2-3p	PAR-CLIP	20371350
MIRT476871	hsa-miR-5003-3p	PAR-CLIP	20371350
MIRT211223	hsa-miR-25-3p	PAR-CLIP	20371350
MIRT028310	hsa-miR-32-5p	PAR-CLIP	20371350
MIRT211227	hsa-miR-363-3p	PAR-CLIP	20371350
MIRT211228	hsa-miR-367-3p	PAR-CLIP	20371350
MIRT049684	hsa-miR-92a-3p	PAR-CLIP	20371350
MIRT211230	hsa-miR-92b-3p	PAR-CLIP	20371350
MIRT476870	hsa-miR-759	PAR-CLIP	20371350
MIRT476869	hsa-miR-5589-3p	PAR-CLIP	20371350
MIRT507255	hsa-miR-708-3p	PAR-CLIP	20371350
MIRT211261	hsa-miR-548p	PAR-CLIP	20371350
MIRT211264	hsa-miR-6504-3p	PAR-CLIP	20371350
MIRT211257	hsa-miR-545-3p	PAR-CLIP	20371350
MIRT211258	hsa-miR-1468-3p	PAR-CLIP	20371350
MIRT007223	hsa-miR-503-5p	PAR-CLIP	20371350
MIRT211195	hsa-miR-562	PAR-CLIP	20371350
MIRT548232	hsa-miR-6074	PAR-CLIP	20371350
MIRT309162	hsa-miR-892c-5p	PAR-CLIP	20371350
MIRT309156	hsa-miR-506-5p	PAR-CLIP	20371350
MIRT211198	hsa-miR-5697	PAR-CLIP	20371350
MIRT507259	hsa-miR-4310	PAR-CLIP	20371350
MIRT507258	hsa-miR-7157-5p	PAR-CLIP	20371350
MIRT507257	hsa-miR-3691-3p	PAR-CLIP	20371350
MIRT309161	hsa-miR-5695	PAR-CLIP	20371350
MIRT211196	hsa-miR-4524a-5p	PAR-CLIP	20371350
MIRT211197	hsa-miR-4524b-5p	PAR-CLIP	20371350
MIRT507256	hsa-miR-4291	PAR-CLIP	20371350
MIRT211231	hsa-miR-548c-3p	PAR-CLIP	20371350
MIRT211229	hsa-miR-495-3p	PAR-CLIP	20371350
MIRT211232	hsa-miR-5688	PAR-CLIP	20371350
MIRT211225	hsa-miR-7-1-3p	PAR-CLIP	20371350
MIRT211226	hsa-miR-7-2-3p	PAR-CLIP	20371350
MIRT476871	hsa-miR-5003-3p	PAR-CLIP	20371350
MIRT211223	hsa-miR-25-3p	PAR-CLIP	20371350
MIRT028310	hsa-miR-32-5p	PAR-CLIP	20371350
MIRT211227	hsa-miR-363-3p	PAR-CLIP	20371350
MIRT211228	hsa-miR-367-3p	PAR-CLIP	20371350
MIRT049684	hsa-miR-92a-3p	PAR-CLIP	20371350
MIRT211230	hsa-miR-92b-3p	PAR-CLIP	20371350
MIRT476870	hsa-miR-759	PAR-CLIP	20371350
MIRT476869	hsa-miR-5589-3p	PAR-CLIP	20371350
MIRT507255	hsa-miR-708-3p	PAR-CLIP	20371350
MIRT211261	hsa-miR-548p	PAR-CLIP	20371350
MIRT211264	hsa-miR-6504-3p	PAR-CLIP	20371350
MIRT211257	hsa-miR-545-3p	PAR-CLIP	20371350
MIRT211258	hsa-miR-1468-3p	PAR-CLIP	20371350
MIRT211210	hsa-miR-6838-5p	PAR-CLIP	20371350
MIRT054815	hsa-miR-15b-5p	PAR-CLIP	20371350
MIRT001468	hsa-miR-16-5p	PAR-CLIP	20371350
MIRT211199	hsa-miR-15a-5p	PAR-CLIP	20371350
MIRT211203	hsa-miR-497-5p	PAR-CLIP	20371350
MIRT211201	hsa-miR-424-5p	PAR-CLIP	20371350
MIRT211200	hsa-miR-195-5p	PAR-CLIP	20371350
MIRT211195	hsa-miR-562	PAR-CLIP	20371350
MIRT548232	hsa-miR-6074	PAR-CLIP	20371350
MIRT309162	hsa-miR-892c-5p	PAR-CLIP	20371350
MIRT309156	hsa-miR-506-5p	PAR-CLIP	20371350
MIRT211198	hsa-miR-5697	PAR-CLIP	20371350
MIRT507259	hsa-miR-4310	PAR-CLIP	20371350
MIRT507258	hsa-miR-7157-5p	PAR-CLIP	20371350
MIRT507257	hsa-miR-3691-3p	PAR-CLIP	20371350
MIRT309161	hsa-miR-5695	PAR-CLIP	20371350
MIRT507256	hsa-miR-4291	PAR-CLIP	20371350
MIRT507255	hsa-miR-708-3p	PAR-CLIP	20371350
MIRT211261	hsa-miR-548p	PAR-CLIP	20371350
MIRT211257	hsa-miR-545-3p	PAR-CLIP	20371350
MIRT211258	hsa-miR-1468-3p	PAR-CLIP	20371350
MIRT211210	hsa-miR-6838-5p	PAR-CLIP	20371350
MIRT054815	hsa-miR-15b-5p	PAR-CLIP	20371350
MIRT001468	hsa-miR-16-5p	PAR-CLIP	20371350
MIRT211199	hsa-miR-15a-5p	PAR-CLIP	20371350
MIRT211203	hsa-miR-497-5p	PAR-CLIP	20371350
MIRT211201	hsa-miR-424-5p	PAR-CLIP	20371350
MIRT211200	hsa-miR-195-5p	PAR-CLIP	20371350
MIRT007223	hsa-miR-503-5p	PAR-CLIP	20371350
MIRT211265	hsa-miR-107	PAR-CLIP	20371350
MIRT027141	hsa-miR-103a-3p	PAR-CLIP	20371350
MIRT562332	hsa-miR-3607-3p	PAR-CLIP	20371350
MIRT211270	hsa-miR-3686	PAR-CLIP	20371350
MIRT562331	hsa-miR-4659a-3p	PAR-CLIP	20371350
MIRT562330	hsa-miR-4659b-3p	PAR-CLIP	20371350
MIRT557872	hsa-miR-7109-3p	PAR-CLIP	21572407
MIRT211195	hsa-miR-562	PAR-CLIP	21572407
MIRT557871	hsa-miR-577	PAR-CLIP	21572407
MIRT557870	hsa-miR-3927-3p	PAR-CLIP	21572407
MIRT557869	hsa-miR-6831-5p	PAR-CLIP	21572407
MIRT548232	hsa-miR-6074	PAR-CLIP	21572407
MIRT309162	hsa-miR-892c-5p	PAR-CLIP	21572407
MIRT309156	hsa-miR-506-5p	PAR-CLIP	21572407
MIRT211198	hsa-miR-5697	PAR-CLIP	21572407
MIRT507259	hsa-miR-4310	PAR-CLIP	21572407
MIRT507258	hsa-miR-7157-5p	PAR-CLIP	21572407
MIRT507257	hsa-miR-3691-3p	PAR-CLIP	21572407
MIRT309161	hsa-miR-5695	PAR-CLIP	21572407
MIRT557868	hsa-miR-3935	PAR-CLIP	21572407
MIRT507256	hsa-miR-4291	PAR-CLIP	21572407
MIRT557867	hsa-miR-199b-3p	PAR-CLIP	21572407
MIRT557866	hsa-miR-199a-3p	PAR-CLIP	21572407
MIRT557865	hsa-miR-3129-5p	PAR-CLIP	21572407
MIRT507255	hsa-miR-708-3p	PAR-CLIP	21572407
MIRT211261	hsa-miR-548p	PAR-CLIP	21572407
MIRT309159	hsa-miR-936	PAR-CLIP	21572407
MIRT557864	hsa-miR-26b-3p	PAR-CLIP	21572407
MIRT211258	hsa-miR-1468-3p	PAR-CLIP	21572407
MIRT537379	hsa-miR-1206	PAR-CLIP	21572407
MIRT537378	hsa-miR-6853-3p	PAR-CLIP	21572407
MIRT309153	hsa-miR-222-5p	PAR-CLIP	21572407
MIRT537377	hsa-miR-376a-3p	PAR-CLIP	21572407
MIRT537376	hsa-miR-376b-3p	PAR-CLIP	21572407
MIRT211195	hsa-miR-562	PAR-CLIP	21572407
MIRT548232	hsa-miR-6074	PAR-CLIP	21572407
MIRT309162	hsa-miR-892c-5p	PAR-CLIP	21572407
MIRT309156	hsa-miR-506-5p	PAR-CLIP	21572407
MIRT211198	hsa-miR-5697	PAR-CLIP	21572407
MIRT507259	hsa-miR-4310	PAR-CLIP	21572407
MIRT507258	hsa-miR-7157-5p	PAR-CLIP	21572407
MIRT507257	hsa-miR-3691-3p	PAR-CLIP	21572407
MIRT309161	hsa-miR-5695	PAR-CLIP	21572407
MIRT507256	hsa-miR-4291	PAR-CLIP	21572407
MIRT211231	hsa-miR-548c-3p	PAR-CLIP	21572407
MIRT211229	hsa-miR-495-3p	PAR-CLIP	21572407
MIRT211232	hsa-miR-5688	PAR-CLIP	21572407
MIRT211225	hsa-miR-7-1-3p	PAR-CLIP	21572407
MIRT211226	hsa-miR-7-2-3p	PAR-CLIP	21572407
MIRT476871	hsa-miR-5003-3p	PAR-CLIP	21572407
MIRT211223	hsa-miR-25-3p	PAR-CLIP	21572407
MIRT028310	hsa-miR-32-5p	PAR-CLIP	21572407
MIRT211227	hsa-miR-363-3p	PAR-CLIP	21572407
MIRT211228	hsa-miR-367-3p	PAR-CLIP	21572407
MIRT049684	hsa-miR-92a-3p	PAR-CLIP	21572407
MIRT211230	hsa-miR-92b-3p	PAR-CLIP	21572407
MIRT476870	hsa-miR-759	PAR-CLIP	21572407
MIRT476869	hsa-miR-5589-3p	PAR-CLIP	21572407
MIRT507255	hsa-miR-708-3p	PAR-CLIP	21572407
MIRT211261	hsa-miR-548p	PAR-CLIP	21572407
MIRT211264	hsa-miR-6504-3p	PAR-CLIP	21572407
MIRT211257	hsa-miR-545-3p	PAR-CLIP	21572407
MIRT211258	hsa-miR-1468-3p	PAR-CLIP	21572407
MIRT537389	hsa-miR-4789-3p	PAR-CLIP	22012620
MIRT537387	hsa-miR-4643	PAR-CLIP	22012620
MIRT537386	hsa-miR-4729	PAR-CLIP	22012620
MIRT537385	hsa-miR-1284	PAR-CLIP	22012620
MIRT537384	hsa-miR-466	PAR-CLIP	22012620
MIRT211211	hsa-miR-181c-3p	PAR-CLIP	22012620
MIRT476871	hsa-miR-5003-3p	PAR-CLIP	22012620
MIRT211223	hsa-miR-25-3p	PAR-CLIP	22012620
MIRT028310	hsa-miR-32-5p	PAR-CLIP	22012620
MIRT211227	hsa-miR-363-3p	PAR-CLIP	22012620
MIRT211228	hsa-miR-367-3p	PAR-CLIP	22012620
MIRT049684	hsa-miR-92a-3p	PAR-CLIP	22012620
MIRT211230	hsa-miR-92b-3p	PAR-CLIP	22012620
MIRT476870	hsa-miR-759	PAR-CLIP	22012620
MIRT537383	hsa-miR-302a-5p	PAR-CLIP	22012620
MIRT537382	hsa-miR-627-3p	PAR-CLIP	22012620
MIRT476869	hsa-miR-5589-3p	PAR-CLIP	22012620
MIRT211237	hsa-miR-101-3p	PAR-CLIP	22012620
MIRT537381	hsa-miR-3529-3p	PAR-CLIP	22012620
MIRT211237	hsa-miR-101-3p	PAR-CLIP	22012620
MIRT211238	hsa-miR-144-3p	PAR-CLIP	22012620
MIRT211239	hsa-miR-600	PAR-CLIP	22012620
MIRT537380	hsa-miR-582-5p	PAR-CLIP	22012620
MIRT507255	hsa-miR-708-3p	PAR-CLIP	22012620
MIRT211261	hsa-miR-548p	PAR-CLIP	22012620
MIRT211264	hsa-miR-6504-3p	PAR-CLIP	22012620
MIRT211257	hsa-miR-545-3p	PAR-CLIP	22012620
MIRT211258	hsa-miR-1468-3p	PAR-CLIP	22012620
MIRT537379	hsa-miR-1206	PAR-CLIP	22012620
MIRT537378	hsa-miR-6853-3p	PAR-CLIP	22012620
MIRT537377	hsa-miR-376a-3p	PAR-CLIP	22012620
MIRT537376	hsa-miR-376b-3p	PAR-CLIP	22012620
MIRT507255	hsa-miR-708-3p	PAR-CLIP	23446348
MIRT211261	hsa-miR-548p	PAR-CLIP	23446348
MIRT211264	hsa-miR-6504-3p	PAR-CLIP	23446348
MIRT211257	hsa-miR-545-3p	PAR-CLIP	23446348
MIRT211258	hsa-miR-1468-3p	PAR-CLIP	23446348
MIRT001468	hsa-miR-16-5p	PAR-CLIP	23446348
MIRT211201	hsa-miR-424-5p	PAR-CLIP	23446348
MIRT211210	hsa-miR-6838-5p	PAR-CLIP	23446348
MIRT211199	hsa-miR-15a-5p	PAR-CLIP	23446348
MIRT211200	hsa-miR-195-5p	PAR-CLIP	23446348
MIRT054815	hsa-miR-15b-5p	PAR-CLIP	23446348
MIRT211203	hsa-miR-497-5p	PAR-CLIP	23446348
MIRT007223	hsa-miR-503-5p	PAR-CLIP	23446348
MIRT507255	hsa-miR-708-3p	PAR-CLIP	23446348
MIRT211261	hsa-miR-548p	PAR-CLIP	23446348
MIRT211252	hsa-miR-646	PAR-CLIP	23446348
MIRT211264	hsa-miR-6504-3p	PAR-CLIP	23446348
MIRT211257	hsa-miR-545-3p	PAR-CLIP	23446348
MIRT211258	hsa-miR-1468-3p	PAR-CLIP	23446348
MIRT211196	hsa-miR-4524a-5p	PAR-CLIP	23446348
MIRT211197	hsa-miR-4524b-5p	PAR-CLIP	23446348
MIRT507255	hsa-miR-708-3p	PAR-CLIP	23446348
MIRT211261	hsa-miR-548p	PAR-CLIP	23446348
MIRT211264	hsa-miR-6504-3p	PAR-CLIP	23446348
MIRT211257	hsa-miR-545-3p	PAR-CLIP	23446348
MIRT211258	hsa-miR-1468-3p	PAR-CLIP	23446348
MIRT007223	hsa-miR-503-5p	PAR-CLIP	23446348
MIRT211195	hsa-miR-562	PAR-CLIP	23446348
MIRT309162	hsa-miR-892c-5p	PAR-CLIP	23446348
MIRT309156	hsa-miR-506-5p	PAR-CLIP	23446348
MIRT211198	hsa-miR-5697	PAR-CLIP	23446348
MIRT507259	hsa-miR-4310	PAR-CLIP	23446348
MIRT507258	hsa-miR-7157-5p	PAR-CLIP	23446348
MIRT507257	hsa-miR-3691-3p	PAR-CLIP	23446348
MIRT309161	hsa-miR-5695	PAR-CLIP	23446348
MIRT211196	hsa-miR-4524a-5p	PAR-CLIP	23446348
MIRT211197	hsa-miR-4524b-5p	PAR-CLIP	23446348
MIRT507256	hsa-miR-4291	PAR-CLIP	23446348
MIRT211229	hsa-miR-495-3p	PAR-CLIP	23446348
MIRT211232	hsa-miR-5688	PAR-CLIP	23446348
MIRT211225	hsa-miR-7-1-3p	PAR-CLIP	23446348
MIRT211226	hsa-miR-7-2-3p	PAR-CLIP	23446348
MIRT476871	hsa-miR-5003-3p	PAR-CLIP	23446348
MIRT211223	hsa-miR-25-3p	PAR-CLIP	23446348
MIRT028310	hsa-miR-32-5p	PAR-CLIP	23446348
MIRT211227	hsa-miR-363-3p	PAR-CLIP	23446348
MIRT211228	hsa-miR-367-3p	PAR-CLIP	23446348
MIRT049684	hsa-miR-92a-3p	PAR-CLIP	23446348
MIRT211230	hsa-miR-92b-3p	PAR-CLIP	23446348
MIRT476870	hsa-miR-759	PAR-CLIP	23446348
MIRT476869	hsa-miR-5589-3p	PAR-CLIP	23446348
MIRT507255	hsa-miR-708-3p	PAR-CLIP	23446348
MIRT211261	hsa-miR-548p	PAR-CLIP	23446348
MIRT211264	hsa-miR-6504-3p	PAR-CLIP	23446348
MIRT211258	hsa-miR-1468-3p	PAR-CLIP	23446348
MIRT211231	hsa-miR-548c-3p	PAR-CLIP	23592263
MIRT211229	hsa-miR-495-3p	PAR-CLIP	23592263
MIRT211232	hsa-miR-5688	PAR-CLIP	23592263
MIRT211225	hsa-miR-7-1-3p	PAR-CLIP	23592263
MIRT211226	hsa-miR-7-2-3p	PAR-CLIP	23592263
MIRT476871	hsa-miR-5003-3p	PAR-CLIP	23592263
MIRT211223	hsa-miR-25-3p	PAR-CLIP	23592263
MIRT028310	hsa-miR-32-5p	PAR-CLIP	23592263
MIRT211227	hsa-miR-363-3p	PAR-CLIP	23592263
MIRT211228	hsa-miR-367-3p	PAR-CLIP	23592263
MIRT049684	hsa-miR-92a-3p	PAR-CLIP	23592263
MIRT211230	hsa-miR-92b-3p	PAR-CLIP	23592263
MIRT476870	hsa-miR-759	PAR-CLIP	23592263
MIRT476869	hsa-miR-5589-3p	PAR-CLIP	23592263
MIRT731959	hsa-miR-196a-3p	Microarray, qRT-PCR, Western blot	28317323
MIRT731959	hsa-miR-196a-3p	Microarray, qRT-PCR, Western blot	28317323
MIRT001468	hsa-miR-16-5p	Immunofluorescence, Luciferase reporter assay, qRT-PCR, Western blot, mice xenograft	26655091
MIRT001468	hsa-miR-16-5p	Immunofluorescence, Luciferase reporter assay, qRT-PCR, Western blot, mice xenograft	26655091
MIRT001468	hsa-miR-16-5p	Immunofluorescence, Luciferase reporter assay, qRT-PCR, Western blot, mice xenograft	26655091
MIRT001468	hsa-miR-16-5p	Immunofluorescence, Luciferase reporter assay, qRT-PCR, Western blot, mice xenograft	26655091
MIRT211200	hsa-miR-195-5p	Luciferase reporter assay, qRT-PCR, Western blot	28500362
MIRT211200	hsa-miR-195-5p	Luciferase reporter assay, qRT-PCR, Western blot	28500362
MIRT211201	hsa-miR-424-5p	qRT-PCR, Western blot	28186136
MIRT211201	hsa-miR-424-5p	qRT-PCR, Western blot	28186136
MIRT021161	hsa-miR-186-5p	Luciferase reporter assay	28213656
MIRT021161	hsa-miR-186-5p	Luciferase reporter assay	28213656
MIRT211200	hsa-miR-195-5p	ELISA, Luciferase reporter assay	26823724
MIRT211200	hsa-miR-195-5p	ELISA, Luciferase reporter assay	26823724
MIRT211200	hsa-miR-195-5p	ELISA, Luciferase reporter assay	26823724
MIRT211200	hsa-miR-195-5p	ELISA, Luciferase reporter assay	26823724
MIRT732432	hsa-miR-23a-3p	ELISA, Western blotting, Northern blotting, qRT-PCR, Quantitative proteomic approach	33632989
MIRT733848	hsa-miR-877-3p	Luciferase reporter assay, qRT-PCR, Western blotting	32977766
MIRT211200	hsa-miR-195-5p	Luciferase reporter assay, Western blotting, qRT-PCR	33953601
MIRT736271	hsa-miR-96-3p	Western blotting, qRT-PCR	32116694
MIRT724422	hsa-miR-3653-5p	HITS-CLIP	19536157
MIRT724421	hsa-miR-1976	HITS-CLIP	19536157
MIRT724420	hsa-miR-3671	HITS-CLIP	19536157
MIRT724419	hsa-miR-607	HITS-CLIP	19536157
MIRT724418	hsa-miR-1305	HITS-CLIP	19536157
MIRT211231	hsa-miR-548c-3p	HITS-CLIP	21572407
MIRT211229	hsa-miR-495-3p	HITS-CLIP	21572407
MIRT211232	hsa-miR-5688	HITS-CLIP	21572407
MIRT211225	hsa-miR-7-1-3p	HITS-CLIP	21572407
MIRT211226	hsa-miR-7-2-3p	HITS-CLIP	21572407
MIRT476871	hsa-miR-5003-3p	HITS-CLIP	21572407
MIRT211223	hsa-miR-25-3p	HITS-CLIP	21572407
MIRT028310	hsa-miR-32-5p	HITS-CLIP	21572407
MIRT211227	hsa-miR-363-3p	HITS-CLIP	21572407
MIRT211228	hsa-miR-367-3p	HITS-CLIP	21572407
MIRT049684	hsa-miR-92a-3p	HITS-CLIP	21572407
MIRT211230	hsa-miR-92b-3p	HITS-CLIP	21572407
MIRT476870	hsa-miR-759	HITS-CLIP	21572407
MIRT476869	hsa-miR-5589-3p	HITS-CLIP	21572407
MIRT557867	hsa-miR-199b-3p	HITS-CLIP	21572407
MIRT557866	hsa-miR-199a-3p	HITS-CLIP	21572407
MIRT557865	hsa-miR-3129-5p	HITS-CLIP	21572407
MIRT507255	hsa-miR-708-3p	HITS-CLIP	21572407
MIRT211261	hsa-miR-548p	HITS-CLIP	21572407
MIRT211264	hsa-miR-6504-3p	HITS-CLIP	21572407
MIRT211257	hsa-miR-545-3p	HITS-CLIP	21572407
MIRT309159	hsa-miR-936	HITS-CLIP	21572407
MIRT557864	hsa-miR-26b-3p	HITS-CLIP	21572407
MIRT211258	hsa-miR-1468-3p	HITS-CLIP	21572407
MIRT537379	hsa-miR-1206	HITS-CLIP	21572407
MIRT537378	hsa-miR-6853-3p	HITS-CLIP	21572407
MIRT309153	hsa-miR-222-5p	HITS-CLIP	21572407
MIRT537377	hsa-miR-376a-3p	HITS-CLIP	21572407
MIRT537376	hsa-miR-376b-3p	HITS-CLIP	21572407
MIRT001468	hsa-miR-16-5p	PAR-CLIP	20371350
MIRT211201	hsa-miR-424-5p	PAR-CLIP	20371350
MIRT211210	hsa-miR-6838-5p	PAR-CLIP	20371350
MIRT211199	hsa-miR-15a-5p	PAR-CLIP	20371350
MIRT211200	hsa-miR-195-5p	PAR-CLIP	20371350
MIRT054815	hsa-miR-15b-5p	PAR-CLIP	20371350
MIRT211203	hsa-miR-497-5p	PAR-CLIP	20371350
MIRT211204	hsa-miR-1276	PAR-CLIP	20371350
MIRT211205	hsa-miR-2278	PAR-CLIP	20371350
MIRT211209	hsa-miR-451b	PAR-CLIP	20371350
MIRT211208	hsa-miR-4670-3p	PAR-CLIP	20371350
MIRT211206	hsa-miR-3148	PAR-CLIP	20371350
MIRT211207	hsa-miR-4668-5p	PAR-CLIP	20371350
MIRT574775	hsa-miR-3153	PAR-CLIP	20371350
MIRT574774	hsa-miR-6733-5p	PAR-CLIP	20371350
MIRT574773	hsa-miR-6739-5p	PAR-CLIP	20371350
MIRT211202	hsa-miR-450a-1-3p	PAR-CLIP	20371350
MIRT574772	hsa-miR-3122	PAR-CLIP	20371350
MIRT574771	hsa-miR-3913-5p	PAR-CLIP	20371350
MIRT574770	hsa-miR-887-5p	PAR-CLIP	20371350
MIRT574769	hsa-miR-6513-5p	PAR-CLIP	20371350
MIRT507255	hsa-miR-708-3p	PAR-CLIP	20371350
MIRT211261	hsa-miR-548p	PAR-CLIP	20371350
MIRT211264	hsa-miR-6504-3p	PAR-CLIP	20371350
MIRT211257	hsa-miR-545-3p	PAR-CLIP	20371350
MIRT211258	hsa-miR-1468-3p	PAR-CLIP	20371350
MIRT007223	hsa-miR-503-5p	PAR-CLIP	20371350
MIRT211195	hsa-miR-562	PAR-CLIP	20371350
MIRT548232	hsa-miR-6074	PAR-CLIP	20371350
MIRT309162	hsa-miR-892c-5p	PAR-CLIP	20371350
MIRT309156	hsa-miR-506-5p	PAR-CLIP	20371350
MIRT211198	hsa-miR-5697	PAR-CLIP	20371350
MIRT507259	hsa-miR-4310	PAR-CLIP	20371350
MIRT507258	hsa-miR-7157-5p	PAR-CLIP	20371350
MIRT507257	hsa-miR-3691-3p	PAR-CLIP	20371350
MIRT309161	hsa-miR-5695	PAR-CLIP	20371350
MIRT211196	hsa-miR-4524a-5p	PAR-CLIP	20371350
MIRT211197	hsa-miR-4524b-5p	PAR-CLIP	20371350
MIRT507256	hsa-miR-4291	PAR-CLIP	20371350
MIRT211231	hsa-miR-548c-3p	PAR-CLIP	20371350
MIRT211229	hsa-miR-495-3p	PAR-CLIP	20371350
MIRT211232	hsa-miR-5688	PAR-CLIP	20371350
MIRT211225	hsa-miR-7-1-3p	PAR-CLIP	20371350
MIRT211226	hsa-miR-7-2-3p	PAR-CLIP	20371350
MIRT476871	hsa-miR-5003-3p	PAR-CLIP	20371350
MIRT211223	hsa-miR-25-3p	PAR-CLIP	20371350
MIRT028310	hsa-miR-32-5p	PAR-CLIP	20371350
MIRT211227	hsa-miR-363-3p	PAR-CLIP	20371350
MIRT211228	hsa-miR-367-3p	PAR-CLIP	20371350
MIRT049684	hsa-miR-92a-3p	PAR-CLIP	20371350
MIRT211230	hsa-miR-92b-3p	PAR-CLIP	20371350
MIRT476870	hsa-miR-759	PAR-CLIP	20371350
MIRT476869	hsa-miR-5589-3p	PAR-CLIP	20371350
MIRT507255	hsa-miR-708-3p	PAR-CLIP	20371350
MIRT211261	hsa-miR-548p	PAR-CLIP	20371350
MIRT211264	hsa-miR-6504-3p	PAR-CLIP	20371350
MIRT211257	hsa-miR-545-3p	PAR-CLIP	20371350
MIRT211258	hsa-miR-1468-3p	PAR-CLIP	20371350
MIRT007223	hsa-miR-503-5p	PAR-CLIP	20371350
MIRT211195	hsa-miR-562	PAR-CLIP	20371350
MIRT548232	hsa-miR-6074	PAR-CLIP	20371350
MIRT309162	hsa-miR-892c-5p	PAR-CLIP	20371350
MIRT309156	hsa-miR-506-5p	PAR-CLIP	20371350
MIRT211198	hsa-miR-5697	PAR-CLIP	20371350
MIRT507259	hsa-miR-4310	PAR-CLIP	20371350
MIRT507258	hsa-miR-7157-5p	PAR-CLIP	20371350
MIRT507257	hsa-miR-3691-3p	PAR-CLIP	20371350
MIRT309161	hsa-miR-5695	PAR-CLIP	20371350
MIRT211196	hsa-miR-4524a-5p	PAR-CLIP	20371350
MIRT211197	hsa-miR-4524b-5p	PAR-CLIP	20371350
MIRT507256	hsa-miR-4291	PAR-CLIP	20371350
MIRT211231	hsa-miR-548c-3p	PAR-CLIP	20371350
MIRT211229	hsa-miR-495-3p	PAR-CLIP	20371350
MIRT211232	hsa-miR-5688	PAR-CLIP	20371350
MIRT211225	hsa-miR-7-1-3p	PAR-CLIP	20371350
MIRT211226	hsa-miR-7-2-3p	PAR-CLIP	20371350
MIRT476871	hsa-miR-5003-3p	PAR-CLIP	20371350
MIRT211223	hsa-miR-25-3p	PAR-CLIP	20371350
MIRT028310	hsa-miR-32-5p	PAR-CLIP	20371350
MIRT211227	hsa-miR-363-3p	PAR-CLIP	20371350
MIRT211228	hsa-miR-367-3p	PAR-CLIP	20371350
MIRT049684	hsa-miR-92a-3p	PAR-CLIP	20371350
MIRT211230	hsa-miR-92b-3p	PAR-CLIP	20371350
MIRT476870	hsa-miR-759	PAR-CLIP	20371350
MIRT476869	hsa-miR-5589-3p	PAR-CLIP	20371350
MIRT507255	hsa-miR-708-3p	PAR-CLIP	20371350
MIRT211261	hsa-miR-548p	PAR-CLIP	20371350
MIRT211264	hsa-miR-6504-3p	PAR-CLIP	20371350
MIRT211257	hsa-miR-545-3p	PAR-CLIP	20371350
MIRT211258	hsa-miR-1468-3p	PAR-CLIP	20371350
MIRT211210	hsa-miR-6838-5p	PAR-CLIP	20371350
MIRT054815	hsa-miR-15b-5p	PAR-CLIP	20371350
MIRT001468	hsa-miR-16-5p	PAR-CLIP	20371350
MIRT211199	hsa-miR-15a-5p	PAR-CLIP	20371350
MIRT211203	hsa-miR-497-5p	PAR-CLIP	20371350
MIRT211201	hsa-miR-424-5p	PAR-CLIP	20371350
MIRT211200	hsa-miR-195-5p	PAR-CLIP	20371350
MIRT211195	hsa-miR-562	PAR-CLIP	20371350
MIRT548232	hsa-miR-6074	PAR-CLIP	20371350
MIRT309162	hsa-miR-892c-5p	PAR-CLIP	20371350
MIRT309156	hsa-miR-506-5p	PAR-CLIP	20371350
MIRT211198	hsa-miR-5697	PAR-CLIP	20371350
MIRT507259	hsa-miR-4310	PAR-CLIP	20371350
MIRT507258	hsa-miR-7157-5p	PAR-CLIP	20371350
MIRT507257	hsa-miR-3691-3p	PAR-CLIP	20371350
MIRT309161	hsa-miR-5695	PAR-CLIP	20371350
MIRT507256	hsa-miR-4291	PAR-CLIP	20371350
MIRT507255	hsa-miR-708-3p	PAR-CLIP	20371350
MIRT211261	hsa-miR-548p	PAR-CLIP	20371350
MIRT211257	hsa-miR-545-3p	PAR-CLIP	20371350
MIRT211258	hsa-miR-1468-3p	PAR-CLIP	20371350
MIRT211210	hsa-miR-6838-5p	PAR-CLIP	20371350
MIRT054815	hsa-miR-15b-5p	PAR-CLIP	20371350
MIRT001468	hsa-miR-16-5p	PAR-CLIP	20371350
MIRT211199	hsa-miR-15a-5p	PAR-CLIP	20371350
MIRT211203	hsa-miR-497-5p	PAR-CLIP	20371350
MIRT211201	hsa-miR-424-5p	PAR-CLIP	20371350
MIRT211200	hsa-miR-195-5p	PAR-CLIP	20371350
MIRT007223	hsa-miR-503-5p	PAR-CLIP	20371350
MIRT211265	hsa-miR-107	PAR-CLIP	20371350
MIRT027141	hsa-miR-103a-3p	PAR-CLIP	20371350
MIRT562332	hsa-miR-3607-3p	PAR-CLIP	20371350
MIRT211270	hsa-miR-3686	PAR-CLIP	20371350
MIRT562331	hsa-miR-4659a-3p	PAR-CLIP	20371350
MIRT562330	hsa-miR-4659b-3p	PAR-CLIP	20371350
MIRT557872	hsa-miR-7109-3p	PAR-CLIP	21572407
MIRT211195	hsa-miR-562	PAR-CLIP	21572407
MIRT557871	hsa-miR-577	PAR-CLIP	21572407
MIRT557870	hsa-miR-3927-3p	PAR-CLIP	21572407
MIRT557869	hsa-miR-6831-5p	PAR-CLIP	21572407
MIRT548232	hsa-miR-6074	PAR-CLIP	21572407
MIRT309162	hsa-miR-892c-5p	PAR-CLIP	21572407
MIRT309156	hsa-miR-506-5p	PAR-CLIP	21572407
MIRT211198	hsa-miR-5697	PAR-CLIP	21572407
MIRT507259	hsa-miR-4310	PAR-CLIP	21572407
MIRT507258	hsa-miR-7157-5p	PAR-CLIP	21572407
MIRT507257	hsa-miR-3691-3p	PAR-CLIP	21572407
MIRT309161	hsa-miR-5695	PAR-CLIP	21572407
MIRT557868	hsa-miR-3935	PAR-CLIP	21572407
MIRT507256	hsa-miR-4291	PAR-CLIP	21572407
MIRT557867	hsa-miR-199b-3p	PAR-CLIP	21572407
MIRT557866	hsa-miR-199a-3p	PAR-CLIP	21572407
MIRT557865	hsa-miR-3129-5p	PAR-CLIP	21572407
MIRT507255	hsa-miR-708-3p	PAR-CLIP	21572407
MIRT211261	hsa-miR-548p	PAR-CLIP	21572407
MIRT309159	hsa-miR-936	PAR-CLIP	21572407
MIRT557864	hsa-miR-26b-3p	PAR-CLIP	21572407
MIRT211258	hsa-miR-1468-3p	PAR-CLIP	21572407
MIRT537379	hsa-miR-1206	PAR-CLIP	21572407
MIRT537378	hsa-miR-6853-3p	PAR-CLIP	21572407
MIRT309153	hsa-miR-222-5p	PAR-CLIP	21572407
MIRT537377	hsa-miR-376a-3p	PAR-CLIP	21572407
MIRT537376	hsa-miR-376b-3p	PAR-CLIP	21572407
MIRT211195	hsa-miR-562	PAR-CLIP	21572407
MIRT548232	hsa-miR-6074	PAR-CLIP	21572407
MIRT309162	hsa-miR-892c-5p	PAR-CLIP	21572407
MIRT309156	hsa-miR-506-5p	PAR-CLIP	21572407
MIRT211198	hsa-miR-5697	PAR-CLIP	21572407
MIRT507259	hsa-miR-4310	PAR-CLIP	21572407
MIRT507258	hsa-miR-7157-5p	PAR-CLIP	21572407
MIRT507257	hsa-miR-3691-3p	PAR-CLIP	21572407
MIRT309161	hsa-miR-5695	PAR-CLIP	21572407
MIRT507256	hsa-miR-4291	PAR-CLIP	21572407
MIRT211231	hsa-miR-548c-3p	PAR-CLIP	21572407
MIRT211229	hsa-miR-495-3p	PAR-CLIP	21572407
MIRT211232	hsa-miR-5688	PAR-CLIP	21572407
MIRT211225	hsa-miR-7-1-3p	PAR-CLIP	21572407
MIRT211226	hsa-miR-7-2-3p	PAR-CLIP	21572407
MIRT476871	hsa-miR-5003-3p	PAR-CLIP	21572407
MIRT211223	hsa-miR-25-3p	PAR-CLIP	21572407
MIRT028310	hsa-miR-32-5p	PAR-CLIP	21572407
MIRT211227	hsa-miR-363-3p	PAR-CLIP	21572407
MIRT211228	hsa-miR-367-3p	PAR-CLIP	21572407
MIRT049684	hsa-miR-92a-3p	PAR-CLIP	21572407
MIRT211230	hsa-miR-92b-3p	PAR-CLIP	21572407
MIRT476870	hsa-miR-759	PAR-CLIP	21572407
MIRT476869	hsa-miR-5589-3p	PAR-CLIP	21572407
MIRT507255	hsa-miR-708-3p	PAR-CLIP	21572407
MIRT211261	hsa-miR-548p	PAR-CLIP	21572407
MIRT211264	hsa-miR-6504-3p	PAR-CLIP	21572407
MIRT211257	hsa-miR-545-3p	PAR-CLIP	21572407
MIRT211258	hsa-miR-1468-3p	PAR-CLIP	21572407
MIRT537389	hsa-miR-4789-3p	PAR-CLIP	22012620
MIRT537387	hsa-miR-4643	PAR-CLIP	22012620
MIRT537386	hsa-miR-4729	PAR-CLIP	22012620
MIRT537385	hsa-miR-1284	PAR-CLIP	22012620
MIRT537384	hsa-miR-466	PAR-CLIP	22012620
MIRT211211	hsa-miR-181c-3p	PAR-CLIP	22012620
MIRT476871	hsa-miR-5003-3p	PAR-CLIP	22012620
MIRT211223	hsa-miR-25-3p	PAR-CLIP	22012620
MIRT028310	hsa-miR-32-5p	PAR-CLIP	22012620
MIRT211227	hsa-miR-363-3p	PAR-CLIP	22012620
MIRT211228	hsa-miR-367-3p	PAR-CLIP	22012620
MIRT049684	hsa-miR-92a-3p	PAR-CLIP	22012620
MIRT211230	hsa-miR-92b-3p	PAR-CLIP	22012620
MIRT476870	hsa-miR-759	PAR-CLIP	22012620
MIRT537383	hsa-miR-302a-5p	PAR-CLIP	22012620
MIRT537382	hsa-miR-627-3p	PAR-CLIP	22012620
MIRT476869	hsa-miR-5589-3p	PAR-CLIP	22012620
MIRT211237	hsa-miR-101-3p	PAR-CLIP	22012620
MIRT537381	hsa-miR-3529-3p	PAR-CLIP	22012620
MIRT211237	hsa-miR-101-3p	PAR-CLIP	22012620
MIRT211238	hsa-miR-144-3p	PAR-CLIP	22012620
MIRT211239	hsa-miR-600	PAR-CLIP	22012620
MIRT537380	hsa-miR-582-5p	PAR-CLIP	22012620
MIRT507255	hsa-miR-708-3p	PAR-CLIP	22012620
MIRT211261	hsa-miR-548p	PAR-CLIP	22012620
MIRT211264	hsa-miR-6504-3p	PAR-CLIP	22012620
MIRT211257	hsa-miR-545-3p	PAR-CLIP	22012620
MIRT211258	hsa-miR-1468-3p	PAR-CLIP	22012620
MIRT537379	hsa-miR-1206	PAR-CLIP	22012620
MIRT537378	hsa-miR-6853-3p	PAR-CLIP	22012620
MIRT537377	hsa-miR-376a-3p	PAR-CLIP	22012620
MIRT537376	hsa-miR-376b-3p	PAR-CLIP	22012620
MIRT507255	hsa-miR-708-3p	PAR-CLIP	23446348
MIRT211261	hsa-miR-548p	PAR-CLIP	23446348
MIRT211264	hsa-miR-6504-3p	PAR-CLIP	23446348
MIRT211257	hsa-miR-545-3p	PAR-CLIP	23446348
MIRT211258	hsa-miR-1468-3p	PAR-CLIP	23446348
MIRT001468	hsa-miR-16-5p	PAR-CLIP	23446348
MIRT211201	hsa-miR-424-5p	PAR-CLIP	23446348
MIRT211210	hsa-miR-6838-5p	PAR-CLIP	23446348
MIRT211199	hsa-miR-15a-5p	PAR-CLIP	23446348
MIRT211200	hsa-miR-195-5p	PAR-CLIP	23446348
MIRT054815	hsa-miR-15b-5p	PAR-CLIP	23446348
MIRT211203	hsa-miR-497-5p	PAR-CLIP	23446348
MIRT007223	hsa-miR-503-5p	PAR-CLIP	23446348
MIRT507255	hsa-miR-708-3p	PAR-CLIP	23446348
MIRT211261	hsa-miR-548p	PAR-CLIP	23446348
MIRT211252	hsa-miR-646	PAR-CLIP	23446348
MIRT211264	hsa-miR-6504-3p	PAR-CLIP	23446348
MIRT211257	hsa-miR-545-3p	PAR-CLIP	23446348
MIRT211258	hsa-miR-1468-3p	PAR-CLIP	23446348
MIRT211196	hsa-miR-4524a-5p	PAR-CLIP	23446348
MIRT211197	hsa-miR-4524b-5p	PAR-CLIP	23446348
MIRT507255	hsa-miR-708-3p	PAR-CLIP	23446348
MIRT211261	hsa-miR-548p	PAR-CLIP	23446348
MIRT211264	hsa-miR-6504-3p	PAR-CLIP	23446348
MIRT211257	hsa-miR-545-3p	PAR-CLIP	23446348
MIRT211258	hsa-miR-1468-3p	PAR-CLIP	23446348
MIRT007223	hsa-miR-503-5p	PAR-CLIP	23446348
MIRT211195	hsa-miR-562	PAR-CLIP	23446348
MIRT309162	hsa-miR-892c-5p	PAR-CLIP	23446348
MIRT309156	hsa-miR-506-5p	PAR-CLIP	23446348
MIRT211198	hsa-miR-5697	PAR-CLIP	23446348
MIRT507259	hsa-miR-4310	PAR-CLIP	23446348
MIRT507258	hsa-miR-7157-5p	PAR-CLIP	23446348
MIRT507257	hsa-miR-3691-3p	PAR-CLIP	23446348
MIRT309161	hsa-miR-5695	PAR-CLIP	23446348
MIRT211196	hsa-miR-4524a-5p	PAR-CLIP	23446348
MIRT211197	hsa-miR-4524b-5p	PAR-CLIP	23446348
MIRT507256	hsa-miR-4291	PAR-CLIP	23446348
MIRT211229	hsa-miR-495-3p	PAR-CLIP	23446348
MIRT211232	hsa-miR-5688	PAR-CLIP	23446348
MIRT211225	hsa-miR-7-1-3p	PAR-CLIP	23446348
MIRT211226	hsa-miR-7-2-3p	PAR-CLIP	23446348
MIRT476871	hsa-miR-5003-3p	PAR-CLIP	23446348
MIRT211223	hsa-miR-25-3p	PAR-CLIP	23446348
MIRT028310	hsa-miR-32-5p	PAR-CLIP	23446348
MIRT211227	hsa-miR-363-3p	PAR-CLIP	23446348
MIRT211228	hsa-miR-367-3p	PAR-CLIP	23446348
MIRT049684	hsa-miR-92a-3p	PAR-CLIP	23446348
MIRT211230	hsa-miR-92b-3p	PAR-CLIP	23446348
MIRT476870	hsa-miR-759	PAR-CLIP	23446348
MIRT476869	hsa-miR-5589-3p	PAR-CLIP	23446348
MIRT507255	hsa-miR-708-3p	PAR-CLIP	23446348
MIRT211261	hsa-miR-548p	PAR-CLIP	23446348
MIRT211264	hsa-miR-6504-3p	PAR-CLIP	23446348
MIRT211258	hsa-miR-1468-3p	PAR-CLIP	23446348
MIRT211231	hsa-miR-548c-3p	PAR-CLIP	23592263
MIRT211229	hsa-miR-495-3p	PAR-CLIP	23592263
MIRT211232	hsa-miR-5688	PAR-CLIP	23592263
MIRT211225	hsa-miR-7-1-3p	PAR-CLIP	23592263
MIRT211226	hsa-miR-7-2-3p	PAR-CLIP	23592263
MIRT476871	hsa-miR-5003-3p	PAR-CLIP	23592263
MIRT211223	hsa-miR-25-3p	PAR-CLIP	23592263
MIRT028310	hsa-miR-32-5p	PAR-CLIP	23592263
MIRT211227	hsa-miR-363-3p	PAR-CLIP	23592263
MIRT211228	hsa-miR-367-3p	PAR-CLIP	23592263
MIRT049684	hsa-miR-92a-3p	PAR-CLIP	23592263
MIRT211230	hsa-miR-92b-3p	PAR-CLIP	23592263
MIRT476870	hsa-miR-759	PAR-CLIP	23592263
MIRT476869	hsa-miR-5589-3p	PAR-CLIP	23592263
MIRT995648	hsa-miR-101	CLIP-seq
MIRT995649	hsa-miR-139-5p	CLIP-seq
MIRT995650	hsa-miR-144	CLIP-seq
MIRT995651	hsa-miR-3613-3p	CLIP-seq
MIRT995652	hsa-miR-361-3p	CLIP-seq
MIRT995653	hsa-miR-3617	CLIP-seq
MIRT995654	hsa-miR-3618	CLIP-seq
MIRT995655	hsa-miR-3681	CLIP-seq
MIRT995656	hsa-miR-4267	CLIP-seq
MIRT995657	hsa-miR-4493	CLIP-seq
MIRT995658	hsa-miR-4685-5p	CLIP-seq
MIRT995659	hsa-miR-4704-3p	CLIP-seq
MIRT995660	hsa-miR-4717-3p	CLIP-seq
MIRT995661	hsa-miR-4766-5p	CLIP-seq
MIRT995662	hsa-miR-4796-5p	CLIP-seq
MIRT995663	hsa-miR-548u	CLIP-seq
MIRT995664	hsa-miR-555	CLIP-seq
MIRT995665	hsa-miR-641	CLIP-seq
MIRT995666	hsa-miR-654-3p	CLIP-seq
MIRT995667	hsa-miR-656	CLIP-seq
MIRT1548689	hsa-miR-3163	CLIP-seq
MIRT1548690	hsa-miR-340	CLIP-seq
MIRT995651	hsa-miR-3613-3p	CLIP-seq
MIRT995652	hsa-miR-361-3p	CLIP-seq
MIRT995656	hsa-miR-4267	CLIP-seq
MIRT1548691	hsa-miR-4789-5p	CLIP-seq
MIRT1548692	hsa-miR-610	CLIP-seq
MIRT1548693	hsa-miR-634	CLIP-seq
MIRT1556350	hsa-miR-106a	CLIP-seq
MIRT1556351	hsa-miR-106b	CLIP-seq
MIRT1556352	hsa-miR-17	CLIP-seq
MIRT1556353	hsa-miR-20a	CLIP-seq
MIRT1556354	hsa-miR-20b	CLIP-seq
MIRT1556355	hsa-miR-302a	CLIP-seq
MIRT1556356	hsa-miR-302b	CLIP-seq
MIRT1556357	hsa-miR-302c	CLIP-seq
MIRT1556358	hsa-miR-302d	CLIP-seq
MIRT1556359	hsa-miR-302e	CLIP-seq
MIRT1556360	hsa-miR-372	CLIP-seq
MIRT1556361	hsa-miR-373	CLIP-seq
MIRT1548691	hsa-miR-4789-5p	CLIP-seq
MIRT1556362	hsa-miR-495	CLIP-seq
MIRT1556363	hsa-miR-519d	CLIP-seq
MIRT1556364	hsa-miR-520a-3p	CLIP-seq
MIRT1556365	hsa-miR-520b	CLIP-seq
MIRT1556366	hsa-miR-520c-3p	CLIP-seq
MIRT1556367	hsa-miR-520d-3p	CLIP-seq
MIRT1556368	hsa-miR-520e	CLIP-seq
MIRT1556369	hsa-miR-520f	CLIP-seq
MIRT1556370	hsa-miR-548t	CLIP-seq
MIRT1548692	hsa-miR-610	CLIP-seq
MIRT1556371	hsa-miR-636	CLIP-seq
MIRT1556372	hsa-miR-93	CLIP-seq
MIRT1995242	hsa-miR-129-5p	CLIP-seq
MIRT1995243	hsa-miR-15a	CLIP-seq
MIRT1995244	hsa-miR-15b	CLIP-seq
MIRT1995245	hsa-miR-16	CLIP-seq
MIRT1995246	hsa-miR-195	CLIP-seq
MIRT1995247	hsa-miR-208a	CLIP-seq
MIRT1995248	hsa-miR-208b	CLIP-seq
MIRT1995249	hsa-miR-2113	CLIP-seq
MIRT1995250	hsa-miR-3658	CLIP-seq
MIRT1995251	hsa-miR-3674	CLIP-seq
MIRT1995252	hsa-miR-424	CLIP-seq
MIRT1995253	hsa-miR-4716-5p	CLIP-seq
MIRT1995254	hsa-miR-4732-5p	CLIP-seq
MIRT1995255	hsa-miR-497	CLIP-seq
MIRT1995256	hsa-miR-499-5p	CLIP-seq
MIRT1995257	hsa-miR-599	CLIP-seq
MIRT2229349	hsa-miR-1226	CLIP-seq
MIRT1995242	hsa-miR-129-5p	CLIP-seq
MIRT2229350	hsa-miR-197	CLIP-seq
MIRT1995249	hsa-miR-2113	CLIP-seq
MIRT2229351	hsa-miR-216a	CLIP-seq
MIRT1548689	hsa-miR-3163	CLIP-seq
MIRT2229352	hsa-miR-3185	CLIP-seq
MIRT2229353	hsa-miR-3545-3p	CLIP-seq
MIRT1995251	hsa-miR-3674	CLIP-seq
MIRT2229354	hsa-miR-380	CLIP-seq
MIRT2229355	hsa-miR-4307	CLIP-seq
MIRT2229356	hsa-miR-4475	CLIP-seq
MIRT2229357	hsa-miR-4528	CLIP-seq
MIRT2229358	hsa-miR-4635	CLIP-seq
MIRT2229359	hsa-miR-4680-5p	CLIP-seq
MIRT2229360	hsa-miR-4691-3p	CLIP-seq
MIRT1995254	hsa-miR-4732-5p	CLIP-seq
MIRT2229361	hsa-miR-4733-3p	CLIP-seq
MIRT2229362	hsa-miR-4762-5p	CLIP-seq
MIRT2229363	hsa-miR-483-5p	CLIP-seq
MIRT2229364	hsa-miR-5096	CLIP-seq
MIRT1995257	hsa-miR-599	CLIP-seq
MIRT2387985	hsa-miR-127-5p	CLIP-seq
MIRT995648	hsa-miR-101	CLIP-seq
MIRT2428898	hsa-miR-103a	CLIP-seq
MIRT2428899	hsa-miR-1184	CLIP-seq
MIRT2428900	hsa-miR-1205	CLIP-seq
MIRT2387985	hsa-miR-127-5p	CLIP-seq
MIRT995650	hsa-miR-144	CLIP-seq
MIRT1995243	hsa-miR-15a	CLIP-seq
MIRT1995244	hsa-miR-15b	CLIP-seq
MIRT1995245	hsa-miR-16	CLIP-seq
MIRT1995246	hsa-miR-195	CLIP-seq
MIRT2428901	hsa-miR-200b	CLIP-seq
MIRT2428902	hsa-miR-200c	CLIP-seq
MIRT2428903	hsa-miR-2355-3p	CLIP-seq
MIRT2428904	hsa-miR-2392	CLIP-seq
MIRT2428905	hsa-miR-3121-3p	CLIP-seq
MIRT2428906	hsa-miR-3158-5p	CLIP-seq
MIRT2428907	hsa-miR-3190	CLIP-seq
MIRT2428908	hsa-miR-335	CLIP-seq
MIRT2229353	hsa-miR-3545-3p	CLIP-seq
MIRT995651	hsa-miR-3613-3p	CLIP-seq
MIRT995652	hsa-miR-361-3p	CLIP-seq
MIRT2428909	hsa-miR-3664-5p	CLIP-seq
MIRT2428910	hsa-miR-376a	CLIP-seq
MIRT2428911	hsa-miR-376b	CLIP-seq
MIRT1995252	hsa-miR-424	CLIP-seq
MIRT995656	hsa-miR-4267	CLIP-seq
MIRT2428912	hsa-miR-4275	CLIP-seq
MIRT2428913	hsa-miR-4282	CLIP-seq
MIRT2428914	hsa-miR-429	CLIP-seq
MIRT2428915	hsa-miR-4328	CLIP-seq
MIRT2428916	hsa-miR-4419a	CLIP-seq
MIRT2428917	hsa-miR-4422	CLIP-seq
MIRT2428918	hsa-miR-450b-5p	CLIP-seq
MIRT2428919	hsa-miR-4510	CLIP-seq
MIRT2428920	hsa-miR-4524	CLIP-seq
MIRT2229358	hsa-miR-4635	CLIP-seq
MIRT2229359	hsa-miR-4680-5p	CLIP-seq
MIRT2428921	hsa-miR-4709-3p	CLIP-seq
MIRT2428922	hsa-miR-486-5p	CLIP-seq
MIRT1995255	hsa-miR-497	CLIP-seq
MIRT2428923	hsa-miR-503	CLIP-seq
MIRT2428924	hsa-miR-507	CLIP-seq
MIRT2428925	hsa-miR-513a-3p	CLIP-seq
MIRT1556369	hsa-miR-520f	CLIP-seq
MIRT2428926	hsa-miR-544	CLIP-seq
MIRT2428927	hsa-miR-545	CLIP-seq
MIRT2428928	hsa-miR-557	CLIP-seq
MIRT1548692	hsa-miR-610	CLIP-seq
MIRT1548693	hsa-miR-634	CLIP-seq
MIRT995667	hsa-miR-656	CLIP-seq
MIRT2428929	hsa-miR-671-5p	CLIP-seq
MIRT2428930	hsa-miR-676	CLIP-seq
MIRT2428931	hsa-miR-877	CLIP-seq
MIRT2428932	hsa-miR-935	CLIP-seq
MIRT2437247	hsa-miR-2681	CLIP-seq
MIRT2437248	hsa-miR-3130-3p	CLIP-seq
MIRT2437249	hsa-miR-4252	CLIP-seq
MIRT2437250	hsa-miR-941	CLIP-seq
MIRT2449664	hsa-miR-1254	CLIP-seq
MIRT2449665	hsa-miR-3116	CLIP-seq
MIRT2449666	hsa-miR-4794	CLIP-seq
MIRT2449667	hsa-miR-661	CLIP-seq
MIRT2532897	hsa-miR-1179	CLIP-seq
MIRT2532898	hsa-miR-1207-3p	CLIP-seq
MIRT2532899	hsa-miR-1246	CLIP-seq
MIRT2532900	hsa-miR-1253	CLIP-seq
MIRT2532901	hsa-miR-1261	CLIP-seq
MIRT2532902	hsa-miR-1299	CLIP-seq
MIRT2532903	hsa-miR-154	CLIP-seq
MIRT2532904	hsa-miR-1972	CLIP-seq
MIRT2428901	hsa-miR-200b	CLIP-seq
MIRT2428902	hsa-miR-200c	CLIP-seq
MIRT2229351	hsa-miR-216a	CLIP-seq
MIRT2532905	hsa-miR-24	CLIP-seq
MIRT2437247	hsa-miR-2681	CLIP-seq
MIRT2532906	hsa-miR-3115	CLIP-seq
MIRT2532907	hsa-miR-3120-5p	CLIP-seq
MIRT2437248	hsa-miR-3130-3p	CLIP-seq
MIRT2532908	hsa-miR-3138	CLIP-seq
MIRT2532909	hsa-miR-3160-5p	CLIP-seq
MIRT2229352	hsa-miR-3185	CLIP-seq
MIRT2532910	hsa-miR-3201	CLIP-seq
MIRT2532911	hsa-miR-323-3p	CLIP-seq
MIRT2532912	hsa-miR-33a	CLIP-seq
MIRT2532913	hsa-miR-33b	CLIP-seq
MIRT2532914	hsa-miR-345	CLIP-seq
MIRT2229353	hsa-miR-3545-3p	CLIP-seq
MIRT2532915	hsa-miR-3607-5p	CLIP-seq
MIRT2532916	hsa-miR-3647-3p	CLIP-seq
MIRT2532917	hsa-miR-3651	CLIP-seq
MIRT2532918	hsa-miR-3662	CLIP-seq
MIRT1995251	hsa-miR-3674	CLIP-seq
MIRT995655	hsa-miR-3681	CLIP-seq
MIRT2532919	hsa-miR-371-5p	CLIP-seq
MIRT2229354	hsa-miR-380	CLIP-seq
MIRT2532920	hsa-miR-3909	CLIP-seq
MIRT2532921	hsa-miR-3941	CLIP-seq
MIRT2532922	hsa-miR-410	CLIP-seq
MIRT2437249	hsa-miR-4252	CLIP-seq
MIRT2532923	hsa-miR-4261	CLIP-seq
MIRT2532924	hsa-miR-4263	CLIP-seq
MIRT2532925	hsa-miR-4284	CLIP-seq
MIRT2428914	hsa-miR-429	CLIP-seq
MIRT2532926	hsa-miR-4427	CLIP-seq
MIRT2229356	hsa-miR-4475	CLIP-seq
MIRT2229357	hsa-miR-4528	CLIP-seq
MIRT2532927	hsa-miR-4646-5p	CLIP-seq
MIRT2532928	hsa-miR-4650-5p	CLIP-seq
MIRT2532929	hsa-miR-4662a-3p	CLIP-seq
MIRT2532930	hsa-miR-4662a-5p	CLIP-seq
MIRT2532931	hsa-miR-4672	CLIP-seq
MIRT2532932	hsa-miR-4679	CLIP-seq
MIRT2532933	hsa-miR-4680-3p	CLIP-seq
MIRT2229359	hsa-miR-4680-5p	CLIP-seq
MIRT2532934	hsa-miR-4694-3p	CLIP-seq
MIRT2532935	hsa-miR-4698	CLIP-seq
MIRT2428921	hsa-miR-4709-3p	CLIP-seq
MIRT1995253	hsa-miR-4716-5p	CLIP-seq
MIRT2532936	hsa-miR-4718	CLIP-seq
MIRT2532937	hsa-miR-4719	CLIP-seq
MIRT2532938	hsa-miR-4731-3p	CLIP-seq
MIRT2532939	hsa-miR-4735-5p	CLIP-seq
MIRT2229362	hsa-miR-4762-5p	CLIP-seq
MIRT995661	hsa-miR-4766-5p	CLIP-seq
MIRT2532940	hsa-miR-4769-3p	CLIP-seq
MIRT2532941	hsa-miR-4782-5p	CLIP-seq
MIRT2532942	hsa-miR-4791	CLIP-seq
MIRT2532943	hsa-miR-4795-3p	CLIP-seq
MIRT2532944	hsa-miR-4801	CLIP-seq
MIRT2532945	hsa-miR-491-3p	CLIP-seq
MIRT2532946	hsa-miR-499-3p	CLIP-seq
MIRT2532947	hsa-miR-499a-3p	CLIP-seq
MIRT2532948	hsa-miR-516b	CLIP-seq
MIRT2532949	hsa-miR-548a-3p	CLIP-seq
MIRT2532950	hsa-miR-548e	CLIP-seq
MIRT2532951	hsa-miR-548f	CLIP-seq
MIRT2532952	hsa-miR-548m	CLIP-seq
MIRT2532953	hsa-miR-561	CLIP-seq
MIRT2532954	hsa-miR-576-3p	CLIP-seq
MIRT2532955	hsa-miR-576-5p	CLIP-seq
MIRT2532956	hsa-miR-582-3p	CLIP-seq
MIRT2532957	hsa-miR-587	CLIP-seq
MIRT2532958	hsa-miR-651	CLIP-seq
MIRT2437250	hsa-miR-941	CLIP-seq
MIRT2532959	hsa-miR-943	CLIP-seq
MIRT2532897	hsa-miR-1179	CLIP-seq
MIRT2532898	hsa-miR-1207-3p	CLIP-seq
MIRT2532900	hsa-miR-1253	CLIP-seq
MIRT2680959	hsa-miR-1258	CLIP-seq
MIRT2532901	hsa-miR-1261	CLIP-seq
MIRT2532902	hsa-miR-1299	CLIP-seq
MIRT2532903	hsa-miR-154	CLIP-seq
MIRT2532904	hsa-miR-1972	CLIP-seq
MIRT2437247	hsa-miR-2681	CLIP-seq
MIRT2532906	hsa-miR-3115	CLIP-seq
MIRT2532907	hsa-miR-3120-5p	CLIP-seq
MIRT2437248	hsa-miR-3130-3p	CLIP-seq
MIRT2532908	hsa-miR-3138	CLIP-seq
MIRT2680960	hsa-miR-3149	CLIP-seq
MIRT2532909	hsa-miR-3160-5p	CLIP-seq
MIRT2229352	hsa-miR-3185	CLIP-seq
MIRT2532910	hsa-miR-3201	CLIP-seq
MIRT2532911	hsa-miR-323-3p	CLIP-seq
MIRT2532915	hsa-miR-3607-5p	CLIP-seq
MIRT2532916	hsa-miR-3647-3p	CLIP-seq
MIRT2532917	hsa-miR-3651	CLIP-seq
MIRT2532918	hsa-miR-3662	CLIP-seq
MIRT1995251	hsa-miR-3674	CLIP-seq
MIRT995655	hsa-miR-3681	CLIP-seq
MIRT2229354	hsa-miR-380	CLIP-seq
MIRT2532920	hsa-miR-3909	CLIP-seq
MIRT2532921	hsa-miR-3941	CLIP-seq
MIRT2680961	hsa-miR-409-3p	CLIP-seq
MIRT2532922	hsa-miR-410	CLIP-seq
MIRT2437249	hsa-miR-4252	CLIP-seq
MIRT2532924	hsa-miR-4263	CLIP-seq
MIRT2532926	hsa-miR-4427	CLIP-seq
MIRT2229357	hsa-miR-4528	CLIP-seq
MIRT2532928	hsa-miR-4650-5p	CLIP-seq
MIRT2532930	hsa-miR-4662a-5p	CLIP-seq
MIRT2532931	hsa-miR-4672	CLIP-seq
MIRT2532933	hsa-miR-4680-3p	CLIP-seq
MIRT2229359	hsa-miR-4680-5p	CLIP-seq
MIRT2532935	hsa-miR-4698	CLIP-seq
MIRT2428921	hsa-miR-4709-3p	CLIP-seq
MIRT1995253	hsa-miR-4716-5p	CLIP-seq
MIRT2532936	hsa-miR-4718	CLIP-seq
MIRT2532937	hsa-miR-4719	CLIP-seq
MIRT2532938	hsa-miR-4731-3p	CLIP-seq
MIRT995661	hsa-miR-4766-5p	CLIP-seq
MIRT2532941	hsa-miR-4782-5p	CLIP-seq
MIRT2532942	hsa-miR-4791	CLIP-seq
MIRT2532944	hsa-miR-4801	CLIP-seq
MIRT2532945	hsa-miR-491-3p	CLIP-seq
MIRT2532946	hsa-miR-499-3p	CLIP-seq
MIRT2532947	hsa-miR-499a-3p	CLIP-seq
MIRT2532948	hsa-miR-516b	CLIP-seq
MIRT2532949	hsa-miR-548a-3p	CLIP-seq
MIRT2532950	hsa-miR-548e	CLIP-seq
MIRT2532951	hsa-miR-548f	CLIP-seq
MIRT2532952	hsa-miR-548m	CLIP-seq
MIRT2532953	hsa-miR-561	CLIP-seq
MIRT2680962	hsa-miR-570	CLIP-seq
MIRT2532954	hsa-miR-576-3p	CLIP-seq
MIRT2532955	hsa-miR-576-5p	CLIP-seq
MIRT2437250	hsa-miR-941	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
EGR1	Activation	8702507
ERG	Repression	12137767
HDAC5	Repression	19351956
HIF1A	Activation	19492421
HOXB7	Activation	21183939;8756643
LMO2	Activation	20955387
PTTG1	Unknown	12213878
STAT1	Activation	23086340
STAT1	Repression	23086340
STAT3	Activation	21418908;23086340
STAT3	Unknown	16540670
TP53	Repression	10029407

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001525	Process	Angiogenesis	IEA
GO:0001525	Process	Angiogenesis	IEA
GO:0001649	Process	Osteoblast differentiation	IEA
GO:0001658	Process	Branching involved in ureteric bud morphogenesis	IDA	12631064
GO:0001658	Process	Branching involved in ureteric bud morphogenesis	IEA
GO:0001759	Process	Organ induction	IEA
GO:0001935	Process	Endothelial cell proliferation	IEA
GO:0001938	Process	Positive regulation of endothelial cell proliferation	IDA	16756958, 31915155
GO:0001938	Process	Positive regulation of endothelial cell proliferation	IEA
GO:0001938	Process	Positive regulation of endothelial cell proliferation	IMP	18059339
GO:0002042	Process	Cell migration involved in sprouting angiogenesis	IDA	18059339
GO:0002042	Process	Cell migration involved in sprouting angiogenesis	IGI	19351956
GO:0002052	Process	Positive regulation of neuroblast proliferation	IEA
GO:0005104	Function	Fibroblast growth factor receptor binding	IBA
GO:0005104	Function	Fibroblast growth factor receptor binding	IEA
GO:0005104	Function	Fibroblast growth factor receptor binding	IPI	2161540, 10830168
GO:0005125	Function	Cytokine activity	IDA	18059339
GO:0005178	Function	Integrin binding	IDA	28302677
GO:0005515	Function	Protein binding	IPI	9700203, 10490103, 10830168, 11030354, 11075807, 11390973, 11716516, 12717444, 14613973, 16257968, 17086194, 18329368, 20363749, 22267482, 23597562, 23597563, 26267536, 33961781, 35384245
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS	10490103
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	2161540
GO:0005615	Component	Extracellular space	IEA
GO:0005615	Component	Extracellular space	TAS	2435575
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0006325	Process	Chromatin organization	IEA
GO:0006366	Process	Transcription by RNA polymerase II	IEA
GO:0006935	Process	Chemotaxis	TAS
GO:0007165	Process	Signal transduction	NAS	9712850
GO:0007265	Process	Ras protein signal transduction	TAS
GO:0007399	Process	Nervous system development	TAS	9576942
GO:0007405	Process	Neuroblast proliferation	IEA
GO:0008083	Function	Growth factor activity	IBA
GO:0008083	Function	Growth factor activity	IDA	18059339, 26451614
GO:0008083	Function	Growth factor activity	IEA
GO:0008201	Function	Heparin binding	IEA
GO:0008283	Process	Cell population proliferation	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IBA
GO:0008284	Process	Positive regulation of cell population proliferation	IDA	2161540
GO:0008284	Process	Positive regulation of cell population proliferation	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IGI	8663044
GO:0008284	Process	Positive regulation of cell population proliferation	TAS	2435575
GO:0008285	Process	Negative regulation of cell population proliferation	IEA
GO:0008543	Process	Fibroblast growth factor receptor signaling pathway	IBA
GO:0008543	Process	Fibroblast growth factor receptor signaling pathway	IDA	16774925, 17500071, 18059339, 20011604, 31915155
GO:0008543	Process	Fibroblast growth factor receptor signaling pathway	IEA
GO:0008543	Process	Fibroblast growth factor receptor signaling pathway	IEA
GO:0008543	Process	Fibroblast growth factor receptor signaling pathway	IGI	2161540, 8663044
GO:0008543	Process	Fibroblast growth factor receptor signaling pathway	IGI	26451614
GO:0008543	Process	Fibroblast growth factor receptor signaling pathway	IPI	10830168
GO:0009792	Process	Embryo development ending in birth or egg hatching	IEA
GO:0009887	Process	Animal organ morphogenesis	TAS	10903182
GO:0010001	Process	Glial cell differentiation	IEA
GO:0010595	Process	Positive regulation of endothelial cell migration	IDA	31915155
GO:0010595	Process	Positive regulation of endothelial cell migration	IEA
GO:0010628	Process	Positive regulation of gene expression	IEA
GO:0010629	Process	Negative regulation of gene expression	NAS	24463821
GO:0010764	Process	Negative regulation of fibroblast migration	IDA	19577615
GO:0014843	Process	Growth factor dependent regulation of skeletal muscle satellite cell proliferation	IMP	18602469
GO:0019956	Function	Chemokine binding	IPI	11708770
GO:0021762	Process	Substantia nigra development	IEA
GO:0021930	Process	Cerebellar granule cell precursor proliferation	IEA
GO:0021940	Process	Positive regulation of cerebellar granule cell precursor proliferation	IEA
GO:0022008	Process	Neurogenesis	IBA
GO:0030154	Process	Cell differentiation	IEA
GO:0030214	Process	Hyaluronan catabolic process	IDA	19577615
GO:0030324	Process	Lung development	IEA
GO:0030334	Process	Regulation of cell migration	IBA
GO:0038001	Process	Paracrine signaling	IEA
GO:0038001	Process	Paracrine signaling	ISS
GO:0040037	Process	Negative regulation of fibroblast growth factor receptor signaling pathway	NAS	24463821
GO:0042056	Function	Chemoattractant activity	IDA	18059339
GO:0042060	Process	Wound healing	IDA	16756958
GO:0042060	Process	Wound healing	TAS	20011604
GO:0042491	Process	Inner ear auditory receptor cell differentiation	IEA
GO:0042660	Process	Positive regulation of cell fate specification	IDA	18635606
GO:0042802	Function	Identical protein binding	IPI	11708770
GO:0043406	Process	Positive regulation of MAP kinase activity	IDA	16756958
GO:0043410	Process	Positive regulation of MAPK cascade	IBA
GO:0043410	Process	Positive regulation of MAPK cascade	IDA	26451614, 31915155
GO:0043410	Process	Positive regulation of MAPK cascade	IEA
GO:0043491	Process	Phosphatidylinositol 3-kinase/protein kinase B signal transduction	IEA
GO:0043536	Process	Positive regulation of blood vessel endothelial cell migration	IDA	18555217, 20011604, 28302677
GO:0043536	Process	Positive regulation of blood vessel endothelial cell migration	IGI	23263626
GO:0043537	Process	Negative regulation of blood vessel endothelial cell migration	IDA	18555217
GO:0043542	Process	Endothelial cell migration	IEA
GO:0045471	Process	Response to ethanol	IEA
GO:0045609	Process	Positive regulation of inner ear auditory receptor cell differentiation	IEA
GO:0045669	Process	Positive regulation of osteoblast differentiation	IEA
GO:0045765	Process	Regulation of angiogenesis	TAS	20011604
GO:0045766	Process	Positive regulation of angiogenesis	IDA	16774925, 20011604, 28302677
GO:0045766	Process	Positive regulation of angiogenesis	IEA
GO:0045766	Process	Positive regulation of angiogenesis	IGI	16774925
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	18059339
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0046668	Process	Regulation of retinal cell programmed cell death	IEA
GO:0048149	Process	Behavioral response to ethanol	IEA
GO:0048598	Process	Embryonic morphogenesis	TAS	20011604
GO:0048661	Process	Positive regulation of smooth muscle cell proliferation	IEA
GO:0048678	Process	Response to axon injury	IEA
GO:0048863	Process	Stem cell differentiation	IEA
GO:0048864	Process	Stem cell development	IEA
GO:0050673	Process	Epithelial cell proliferation	IEA
GO:0050679	Process	Positive regulation of epithelial cell proliferation	IEA
GO:0050918	Process	Positive chemotaxis	IEA
GO:0051209	Process	Release of sequestered calcium ion into cytosol	IDA	20011604
GO:0051726	Process	Regulation of cell cycle	IEA
GO:0051781	Process	Positive regulation of cell division	IEA
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IDA	20011604, 26451614, 31915155
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IEA
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IGI	31915155
GO:0060045	Process	Positive regulation of cardiac muscle cell proliferation	IDA	9553078
GO:0060045	Process	Positive regulation of cardiac muscle cell proliferation	IEA
GO:0060070	Process	Canonical Wnt signaling pathway	IEA
GO:0060128	Process	Corticotropin hormone secreting cell differentiation	IEA
GO:0060129	Process	Thyroid-stimulating hormone-secreting cell differentiation	IEA
GO:0060563	Process	Neuroepithelial cell differentiation	IEA
GO:0060591	Process	Chondroblast differentiation	IDA	17167778
GO:0060644	Process	Mammary gland epithelial cell differentiation	IEA
GO:0060978	Process	Angiogenesis involved in coronary vascular morphogenesis	IEA
GO:0061045	Process	Negative regulation of wound healing	IDA	19577615
GO:0062072	Function	Histone H3K9me2/3 reader activity	IEA
GO:0070371	Process	ERK1 and ERK2 cascade	IEA
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IDA	17167778
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IEA
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IEA
GO:0071260	Process	Cellular response to mechanical stimulus	IEA
GO:0072089	Process	Stem cell proliferation	IEA
GO:0072089	Process	Stem cell proliferation	NAS	25640183
GO:0090049	Process	Regulation of cell migration involved in sprouting angiogenesis	NAS	24463821
GO:0090050	Process	Positive regulation of cell migration involved in sprouting angiogenesis	IDA	28302677
GO:0090263	Process	Positive regulation of canonical Wnt signaling pathway	IEA
GO:0090722	Function	Receptor-receptor interaction	IDA	24157794
GO:1902748	Process	Positive regulation of lens fiber cell differentiation	IDA	29501879
GO:1902895	Process	Positive regulation of miRNA transcription	NAS	24463821
GO:1902913	Process	Positive regulation of neuroepithelial cell differentiation	IEA
GO:1903377	Process	Negative regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway	IEA
GO:1903587	Process	Regulation of blood vessel endothelial cell proliferation involved in sprouting angiogenesis	NAS	24463821
GO:1903672	Process	Positive regulation of sprouting angiogenesis	IDA	16756958
GO:1903672	Process	Positive regulation of sprouting angiogenesis	IEA
GO:1903672	Process	Positive regulation of sprouting angiogenesis	IMP	23469107
GO:1904567	Process	Response to wortmannin	IEA
GO:1904707	Process	Positive regulation of vascular associated smooth muscle cell proliferation	IGI	23263626
GO:1904977	Process	Lymphatic endothelial cell migration	IEA
GO:1905278	Process	Positive regulation of epithelial tube formation	IDA	31915155
GO:1905330	Process	Regulation of morphogenesis of an epithelium	IEA
GO:1905555	Process	Positive regulation of blood vessel branching	IDA	20123964
GO:1905564	Process	Positive regulation of vascular endothelial cell proliferation	IGI	23263626
GO:2000544	Process	Regulation of endothelial cell chemotaxis to fibroblast growth factor	IDA	16756958
GO:2000544	Process	Regulation of endothelial cell chemotaxis to fibroblast growth factor	IEA
GO:2000544	Process	Regulation of endothelial cell chemotaxis to fibroblast growth factor	NAS	24463821
GO:2000546	Process	Positive regulation of endothelial cell chemotaxis to fibroblast growth factor	IDA	16756958
GO:2000573	Process	Positive regulation of DNA biosynthetic process	IDA	16774925
GO:2000573	Process	Positive regulation of DNA biosynthetic process	IGI	16774925
GO:2000647	Process	Negative regulation of stem cell proliferation	IEA
GO:2000648	Process	Positive regulation of stem cell proliferation	IEA
GO:2000738	Process	Positive regulation of stem cell differentiation	IEA
GO:2001028	Process	Positive regulation of endothelial cell chemotaxis	IGI	16774925

Other IDs

• MIM: 134920
• HGNC: 3676
• e!Ensembl: ENSG00000138685

Protein

• UniProt ID: P09038
• Protein name: Fibroblast growth factor 2 (FGF-2) (Basic fibroblast growth factor) (bFGF) (Heparin-binding growth factor 2) (HBGF-2)
• Protein function: Acts as a ligand for FGFR1, FGFR2, FGFR3 and FGFR4 (PubMed:8663044). Also acts as an integrin ligand which is required for FGF2 signaling (PubMed:28302677). Binds to integrin ITGAV:ITGB3 (PubMed:28302677). Plays an important role in the regulati
• PDB: 1BAS, 1BFB, 1BFC, 1BFF, 1BFG, 1BLA, 1BLD, 1CVS, 1EV2, 1FGA, 1FQ9, 1II4, 1IIL, 2BFH, 2FGF, 2M49, 4FGF, 4OEE, 4OEF, 4OEG, 5X1O, 6L4O, 8HU7, 8HUE, 8OM6
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00167	FGF	162 → 282	Fibroblast growth factor	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed in granulosa and cumulus cells. Expressed in hepatocellular carcinoma cells, but not in non-cancerous liver tissue. {ECO:0000269|PubMed:1417798, ECO:0000269|PubMed:1721615}.
• Sequence:

  MVGVGGGDVEDVTPRPGGCQISGRGARGCNGIPGAAAWEAALPRRRPRRHPSVNPRSRAA
  GSPRTRGRRTEERPSGSRLGDRGRGRALPGGRLGGRGRGRAPERVGGRGRGRGTAAPRAA
  PAARGSRPGPAGTMAAGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDG
  RVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERL
  ESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS

• Sequence length: 288

Pathways

KEGG:

EGFR tyrosine kinase inhibitor resistance
MAPK signaling pathway
Ras signaling pathway
Rap1 signaling pathway
Calcium signaling pathway
PI3K-Akt signaling pathway
Signaling pathways regulating pluripotency of stem cells
Regulation of actin cytoskeleton
Kaposi sarcoma-associated herpesvirus infection
Pathways in cancer
Proteoglycans in cancer
Chemical carcinogenesis - receptor activation
Melanoma
Breast cancer
Gastric cancer

Reactome:

PI3K Cascade
PIP3 activates AKT signaling
Signaling by activated point mutants of FGFR1
Signaling by activated point mutants of FGFR3
FGFR4 ligand binding and activation
FGFR1b ligand binding and activation
FGFR3c ligand binding and activation
FGFR1c ligand binding and activation
FGFR2c ligand binding and activation
FGFR2b ligand binding and activation
FGFR3 mutant receptor activation
Activated point mutants of FGFR2
Constitutive Signaling by Aberrant PI3K in Cancer
POU5F1 (OCT4), SOX2, NANOG activate genes related to proliferation
Syndecan interactions
Non-integrin membrane-ECM interactions
Phospholipase C-mediated cascade: FGFR1
Phospholipase C-mediated cascade; FGFR2
Phospholipase C-mediated cascade; FGFR3
Phospholipase C-mediated cascade; FGFR4
Downstream signaling of activated FGFR1
SHC-mediated cascade:FGFR1
PI-3K cascade:FGFR1
FRS-mediated FGFR1 signaling
PI-3K cascade:FGFR2
SHC-mediated cascade:FGFR2
FRS-mediated FGFR2 signaling
SHC-mediated cascade:FGFR3
FRS-mediated FGFR3 signaling
PI-3K cascade:FGFR3
FRS-mediated FGFR4 signaling
SHC-mediated cascade:FGFR4
PI-3K cascade:FGFR4
Negative regulation of FGFR1 signaling
Negative regulation of FGFR2 signaling
Negative regulation of FGFR3 signaling
Negative regulation of FGFR4 signaling
Signaling by FGFR2 in disease
Signaling by FGFR1 in disease
FGFRL1 modulation of FGFR1 signaling
RAF/MAP kinase cascade
Interleukin-4 and Interleukin-13 signaling
PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling
Signaling by FGFR3 point mutants in cancer

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
BONE DISEASES	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BRAIN INFARCTION	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BRAIN INJURIES	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOMEGALY	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC SKIN ULCER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CLEFT LIP	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CLEFT PALATE	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CLEFT UPPER LIP	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COMPLETE UNILATERAL CLEFT LIP	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORNEAL NEOVASCULARIZATION	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DELIRIUM, DEMENTIA, AMNESTIC, COGNITIVE DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSIVE DISORDER	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DERMATITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES, GESTATIONAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC NEUROPATHIES	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC RETINOPATHY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EPILEPSY, TONIC-CLONIC	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ERECTILE DYSFUNCTION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GASTRIC ULCER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GESTATIONAL DIABETES	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY DISEASES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Long QT syndrome	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MENTAL DEPRESSION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MESOTHELIOMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOOD DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL ISCHEMIA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEPHROSCLEROSIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEPHROTIC SYNDROME	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OLIGODENDROGLIOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ORAL SUBMUCOSAL FIBROSIS, INCLUDING OF TONGUE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ORAL SUBMUCOUS FIBROSIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARKINSONIAN DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PERIAPICAL PERIODONTITIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PULMONARY FIBROSIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SARCOIDOSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SEIZURES	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
THROMBOCYTHEMIA, ESSENTIAL	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TONIC-CLONIC EPILEPSY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations