FES (FES proto-oncogene, tyrosine kinase)

Gene

• Entrez ID: 2242
• Gene name: FES proto-oncogene, tyrosine kinase
• Gene symbol: FES
• Synonyms (NCBI Gene): FPS
• Chromosome: 15
• Chromosome location: 15q26.1
• Summary: This gene encodes the human cellular counterpart of a feline sarcoma retrovirus protein with transforming capabilities. The gene product has tyrosine-specific protein kinase activity and that activity is required for maintenance of cellular transformation

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT029960	hsa-miR-26b-5p	Microarray	19088304

Transcription factors

Transcription factor	Regulation	Reference
SP1	Unknown	8657143
SPI1	Unknown	7624145;8657143

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0001578	Process	Microtubule bundle formation	IEA
GO:0004672	Function	Protein kinase activity	IEA
GO:0004713	Function	Protein tyrosine kinase activity	IBA
GO:0004713	Function	Protein tyrosine kinase activity	IDA	11509660
GO:0004713	Function	Protein tyrosine kinase activity	IEA
GO:0004713	Function	Protein tyrosine kinase activity	TAS
GO:0004715	Function	Non-membrane spanning protein tyrosine kinase activity	IDA	15485904
GO:0004715	Function	Non-membrane spanning protein tyrosine kinase activity	IEA
GO:0005515	Function	Protein binding	IPI	18046454, 21044950, 24728074, 25852190, 32707033
GO:0005524	Function	ATP binding	IEA
GO:0005737	Component	Cytoplasm	IDA	11339827
GO:0005737	Component	Cytoplasm	IEA
GO:0005794	Component	Golgi apparatus	IEA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005925	Component	Focal adhesion	IDA	18046454
GO:0005925	Component	Focal adhesion	IEA
GO:0006935	Process	Chemotaxis	IBA
GO:0007098	Process	Centrosome cycle	IEA
GO:0007155	Process	Cell adhesion	IBA
GO:0008017	Function	Microtubule binding	IEA
GO:0008289	Function	Lipid binding	IEA
GO:0008360	Process	Regulation of cell shape	IMP	11509660, 18046454
GO:0009898	Component	Cytoplasmic side of plasma membrane	IDA	18046454, 19001085
GO:0010976	Process	Positive regulation of neuron projection development	IMP	15302586
GO:0015630	Component	Microtubule cytoskeleton	IDA	15485904
GO:0015630	Component	Microtubule cytoskeleton	IEA
GO:0016020	Component	Membrane	IEA
GO:0016301	Function	Kinase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0018108	Process	Peptidyl-tyrosine phosphorylation	IDA	11509660, 15485904
GO:0030155	Process	Regulation of cell adhesion	IMP	11509660
GO:0031116	Process	Positive regulation of microtubule polymerization	IMP	15485904
GO:0031410	Component	Cytoplasmic vesicle	IDA	11339827
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0032273	Process	Positive regulation of protein polymerization	IEA
GO:0034987	Function	Immunoglobulin receptor binding	IDA	19001085
GO:0035091	Function	Phosphatidylinositol binding	IDA	19001085
GO:0042127	Process	Regulation of cell population proliferation	IMP	11509660
GO:0043304	Process	Regulation of mast cell degranulation	IMP	19001085
GO:0045595	Process	Regulation of cell differentiation	IMP	15302586
GO:0045639	Process	Positive regulation of myeloid cell differentiation	IMP	2656706
GO:0045657	Process	Positive regulation of monocyte differentiation	IMP	28389358
GO:0046777	Process	Protein autophosphorylation	IDA	7687763
GO:0051450	Process	Myoblast proliferation	IEA
GO:0051495	Process	Positive regulation of cytoskeleton organization	IEA
GO:0060038	Process	Cardiac muscle cell proliferation	IEA
GO:0060627	Process	Regulation of vesicle-mediated transport	TAS	11339827
GO:0070161	Component	Anchoring junction	IEA
GO:0071305	Process	Cellular response to vitamin D	IMP	28389358
GO:0120035	Process	Regulation of plasma membrane bounded cell projection organization	IEA
GO:1902905	Process	Positive regulation of supramolecular fiber organization	IEA
GO:2000145	Process	Regulation of cell motility	IMP	18046454

Other IDs

• MIM: 190030
• HGNC: 3657
• e!Ensembl: ENSG00000182511

Protein

• UniProt ID: P07332
• Protein name: Tyrosine-protein kinase Fes/Fps (EC 2.7.10.2) (Feline sarcoma/Fujinami avian sarcoma oncogene homolog) (Proto-oncogene c-Fes) (Proto-oncogene c-Fps) (p93c-fes)
• Protein function: Tyrosine-protein kinase that acts downstream of cell surface receptors and plays a role in the regulation of the actin cytoskeleton, microtubule assembly, cell attachment and cell spreading. Plays a role in FCER1 (high affinity immunoglobulin ep
• PDB: 1WQU, 2DCR, 3BKB, 3CBL, 3CD3, 4DYL, 4E93, 6JMF, 7T1K, 7T1L, 8X2T, 8XKP
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00611	FCH	12 → 92	Fes/CIP4, and EFC/F-BAR homology domain	Family
  PF00017	SH2	460 → 530	SH2 domain	Domain
  PF07714	PK_Tyr_Ser-Thr	561 → 814	Protein tyrosine and serine/threonine kinase	Domain

• Tissue specificity: TISSUE SPECIFICITY: Widely expressed. Detected in adult colon epithelium (at protein level) (PubMed:16455651, PubMed:19051325). Expressed in melanocytes (at protein level) (PubMed:28463229). {ECO:0000269|PubMed:16455651, ECO:0000269|PubMed:19051325, ECO:0
• Sequence:

  MGFSSELCSPQGHGVLQQMQEAELRLLEGMRKWMAQRVKSDREYAGLLHHMSLQDSGGQS
  RAISPDSPISQSWAEITSQTEGLSRLLRQHAEDLNSGPLSKLSLLIRERQQLRKTYSEQW
  QQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLF
  AHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDE
  VVAIHREMAAAAARIQPEAEYQGFLRQYGSAPDVPPCVTFDESLLEEGEPLEPGELQLNE
  LTVESVQHTLTSVTDELAVATEMVFRRQEMVTQLQQELRNEEENTHPRERVQLLGKRQVL
  QEALQGLQVALCSQAKLQAQQELLQTKLEHLGPGEPPPVLLLQDDRHSTSSSEQEREGGR
  TPTLEILKSHISGIFRPKFSLPPPLQLIPEVQKPLHEQLWYHGAIPRAEVAELLVHSGDF
  LVRESQGKQEYVLSVLWDGLPRHFIIQSLDNLYRLEGEGFPSIPLLIDHLLSTQQPLTKK
  SGVVLHRAVPKDKWVLNHEDLVLGEQIGRGNFGEVFSGRLRADNTLVAVKSCRETLPPDL
  KAKFLQEARILKQYSHPNIVRLIGVCTQKQPIYIVMELVQGGDFLTFLRTEGARLRVKTL
  LQMVGDAAAGMEYLESKCCIHRDLAARNCLVTEKNVLKISDFGMSREEADGVYAASGGLR
  QVPVKWTAPEALNYGRYSSESDVWSFGILLWETFSLGASPYPNLSNQQTREFVEKGGRLP
  CPELCPDAVFRLMEQCWAYEPGQRPSFSTIYQELQSIRKRHR

• Sequence length: 822

Pathways

KEGG:

Axon guidance

Reactome:

Signaling by SCF-KIT
Sema3A PAK dependent Axon repulsion
CRMPs in Sema3A signaling

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ANDROGENETIC ALOPECIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATRIAL FIBRILLATION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOVASCULAR DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC ISCHEMIC HEART DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERIOSCLEROSIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	CTD, GWAS catalog CTD, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY HEART DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESSENTIAL HYPERTENSION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL INFARCTION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL ISCHEMIA	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS, HIP	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS, KNEE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
POST-TRAUMATIC STRESS DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thymoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma of pancreas	Pancreatic adenocarcinoma	BEFREE	10640145		★☆☆☆☆ Found in Text Mining only
Anaplastic thyroid carcinoma	Anaplastic thyroid cancer	BEFREE	15613457		★☆☆☆☆ Found in Text Mining only
Anemia, Sickle Cell	Anemia	BEFREE	30044349		★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	28867179		★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	28190665		★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	28190665		★☆☆☆☆ Found in Text Mining only
Bloom Syndrome	Bloom Syndrome	BEFREE	8022833, 8079989, 8875252		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	27688475, 29478216, 30176563		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	6281890		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	GWASCAT_DG	30595370		★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	29200424, 30662575		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	28148566		★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	BEFREE	29248482		★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	30542111		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	16455651, 19051325		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	16455651		★☆☆☆☆ Found in Text Mining only
Cone-Rod Dystrophy 2	Cone-rod dystrophy	BEFREE	30001192		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	GWASDB_DG	23202125		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	GWASCAT_DG	28714975, 29212778, 30104761		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Craniosynostosis	Craniosynostosis	BEFREE	28441365		★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	29455896		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	29948786, 30393200		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	29948786, 30393200		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Enteritis	Enteritis	BEFREE	30542111		★☆☆☆☆ Found in Text Mining only
Hematopoietic Neoplasms	Hematopoietic Neoplasms	BEFREE	6538699		★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	GWASDB_DG	21909115		★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	GWASCAT_DG	21909115		★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	29248482		★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	22201778, 2656706		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	8119916	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid	Myeloid leukemia	Pubtator	3170574	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	15667533		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	31038805		★☆☆☆☆ Found in Text Mining only
Lymphoid leukemia	Lymphoid leukemia	BEFREE	1373879		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	1373879		★☆☆☆☆ Found in Text Mining only
Malignant Fibrous Histiocytoma	Malignant Histiocytoma	BEFREE	17094458		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	27688475, 29478216, 30176563		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	22202072, 28463229, 31573955		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	28463229		★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	29455896		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	31796702		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia	Myeloid Leukemia	BEFREE	15869408		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	GWASCAT_DG	26343387		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neoplasms	Neoplasms	BEFREE	10640145, 16455651, 17094458, 19051325, 2177639, 22202072, 22337690, 25520392, 2555699, 25617853, 27669433, 27872957, 27908969, 28463229, 28952025, 29478216, 29602822, 2986115, 31038805, 7541646, 8703122		★☆☆☆☆ Found in Text Mining only
Nonorganic psychosis	Nonorganic Psychosis	BEFREE	20627207		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	29455896		★☆☆☆☆ Found in Text Mining only
Oestrogen receptor positive breast cancer	Oestrogen Receptor Positive Breast Cancer	BEFREE	29485433, 31337657		★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	30014569, 31279300		★☆☆☆☆ Found in Text Mining only
Paroxysmal nocturnal hemoglobinuria	Paroxysmal nocturnal hemoglobinuria	BEFREE	19679885		★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychosis	BEFREE	20627207		★☆☆☆☆ Found in Text Mining only
Pulmonary Emphysema	Pulmonary Emphysema	BEFREE	28148566		★☆☆☆☆ Found in Text Mining only
Renal fibrosis	Renal fibrosis	BEFREE	30393200		★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	LHGDN	15929003		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	GWASCAT_DG	30285260		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	24667986		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	14595756		★☆☆☆☆ Found in Text Mining only
Subarachnoid Hemorrhage	Subarachnoid hemorrhage	BEFREE	28606778		★☆☆☆☆ Found in Text Mining only