FDXR (ferredoxin reductase)

Gene

• Entrez ID: 2232
• Gene name: Ferredoxin reductase
• Gene symbol: FDXR
• Synonyms (NCBI Gene): ADR, ADXR, ANOA, MMDS9B
• Chromosome: 17
• Chromosome location: 17q25.1
• Summary: This gene encodes a mitochondrial flavoprotein that initiates electron transport for cytochromes P450 receiving electrons from NADPH. Multiple alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Apr 2012]

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs752143061	G>A	Likely-pathogenic	Coding sequence variant, missense variant, non coding transcript variant
rs760030067	G>A,C	Likely-pathogenic	Coding sequence variant, stop gained, missense variant, non coding transcript variant
rs997026784	C>T	Pathogenic	Missense variant, non coding transcript variant, coding sequence variant
rs1313895172	G>A,T	Pathogenic	Missense variant, coding sequence variant, stop gained, non coding transcript variant
rs1323016653	T>A,C,G	Pathogenic	Initiator codon variant, genic upstream transcript variant, missense variant, non coding transcript variant
rs1441084539	C>T	Likely-pathogenic	Non coding transcript variant, missense variant, coding sequence variant
rs1555620021	G>C	Pathogenic	Non coding transcript variant, coding sequence variant, missense variant
rs1598515363	C>-	Likely-pathogenic	Frameshift variant, coding sequence variant, non coding transcript variant
rs1598518754	T>A	Likely-pathogenic	Missense variant, coding sequence variant, non coding transcript variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT029194	hsa-miR-26b-5p	Microarray	19088304
MIRT031555	hsa-miR-16-5p	Proteomics	18668040
MIRT041149	hsa-miR-500a-3p	CLASH	23622248
MIRT037989	hsa-miR-501-3p	CLASH	23622248
MIRT994434	hsa-miR-129-3p	CLIP-seq
MIRT994435	hsa-miR-2355-5p	CLIP-seq
MIRT994436	hsa-miR-4283	CLIP-seq
MIRT994437	hsa-miR-4419a	CLIP-seq
MIRT994438	hsa-miR-4459	CLIP-seq
MIRT994439	hsa-miR-4488	CLIP-seq
MIRT994440	hsa-miR-4489	CLIP-seq
MIRT994441	hsa-miR-4492	CLIP-seq
MIRT994442	hsa-miR-4498	CLIP-seq
MIRT994443	hsa-miR-4505	CLIP-seq
MIRT994444	hsa-miR-4508	CLIP-seq
MIRT994445	hsa-miR-4510	CLIP-seq
MIRT994446	hsa-miR-4697-5p	CLIP-seq
MIRT994447	hsa-miR-4731-5p	CLIP-seq
MIRT994448	hsa-miR-4779	CLIP-seq
MIRT994449	hsa-miR-665	CLIP-seq
MIRT994450	hsa-miR-711	CLIP-seq
MIRT994451	hsa-miR-762	CLIP-seq
MIRT994434	hsa-miR-129-3p	CLIP-seq
MIRT994450	hsa-miR-711	CLIP-seq
MIRT994434	hsa-miR-129-3p	CLIP-seq
MIRT2228980	hsa-miR-150	CLIP-seq
MIRT994450	hsa-miR-711	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
TP53	Unknown	12370809
TP63	Unknown	12370809
TP73	Unknown	12370809

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004324	Function	Ferredoxin-NADP+ reductase activity	IBA
GO:0004324	Function	Ferredoxin-NADP+ reductase activity	IDA	38425362
GO:0004324	Function	Ferredoxin-NADP+ reductase activity	IEA
GO:0004324	Function	Ferredoxin-NADP+ reductase activity	TAS	2845396
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IBA
GO:0005739	Component	Mitochondrion	IDA	29040572
GO:0005739	Component	Mitochondrion	IDA
GO:0005739	Component	Mitochondrion	IEA
GO:0005739	Component	Mitochondrion	TAS	2845396
GO:0005743	Component	Mitochondrial inner membrane	IEA
GO:0005759	Component	Mitochondrial matrix	TAS
GO:0006091	Process	Generation of precursor metabolites and energy	TAS	2845396
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006694	Process	Steroid biosynthetic process	IBA
GO:0006694	Process	Steroid biosynthetic process	TAS	1863359
GO:0006744	Process	Ubiquinone biosynthetic process	IDA	38425362
GO:0008202	Process	Steroid metabolic process	IEA
GO:0008203	Process	Cholesterol metabolic process	IEA
GO:0016020	Component	Membrane	IEA
GO:0016491	Function	Oxidoreductase activity	IEA

Other IDs

• MIM: 103270
• HGNC: 3642
• e!Ensembl: ENSG00000161513

Protein

• UniProt ID: P22570
• Protein name: NADPH:adrenodoxin oxidoreductase, mitochondrial (AR) (Adrenodoxin reductase) (EC 1.18.1.6) (Ferredoxin--NADP(+) reductase) (Ferredoxin reductase) (EC 1.18.1.-)
• Protein function: Serves as the first electron transfer protein in all the mitochondrial P450 systems including cholesterol side chain cleavage in all steroidogenic tissues, steroid 11-beta hydroxylation in the adrenal cortex, 25-OH-vitamin D3-24 hydroxylation in
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF07992	Pyr_redox_2	39 → 224	Pyridine nucleotide-disulphide oxidoreductase	Domain

• Sequence:

  MASRCWRWWGWSAWPRTRLPPAGSTPSFCHHFSTQEKTPQICVVGSGPAGFYTAQHLLKH
  PQAHVDIYEKQPVPFGLVRFGVAPDHPEVKNVINTFTQTAHSGRCAFWGNVEVGRDVTVP
  ELREAYHAVVLSYGAEDHRALEIPGEELPGVCSARAFVGWYNGLPENQELEPDLSCDTAV
  ILGQGNVALDVARILLTPPEHLERTDITKAALGVLRQSRVKTVWLVGRRGPLQVAFTIKE
  LREMIQLPGARPILDPVDFLGLQDKIKEVPRPRKRLTELLLRTATEKPGPAEAARQASAS
  RAWGLRFFRSPQQVLPSPDGRRAAGVRLAVTRLEGVDEATRAVPTGDMEDLPCGLVLSSI
  GYKSRPVDPSVPFDSKLGVIPNVEGRVMDVPGLYCSGWVKRGPTGVIATTMTDSFLTGQM
  LLQDLKAGLLPSGPRPGYAAIQALLSSRGVRPVSFSDWEKLDAEEVARGQGTGKPREKLV
  DPQEMLRLLGH

• Sequence length: 491

Pathways

Reactome:

Pregnenolone biosynthesis
Endogenous sterols
Electron transport from NADPH to Ferredoxin
Defective CYP11A1 causes Adrenal insufficiency, congenital, with 46,XY sex reversal (AICSR)

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Auditory neuropathy-optic atrophy syndrome	Likely pathogenic; Pathogenic	rs2144662023, rs752001360, rs2509785660, rs752143061, rs1313895172, rs1555620021, rs1323016653, rs760345680, rs1598518754, rs1441084539, rs752675360	RCV001822885 RCV002468708 RCV002468709 RCV000509578 RCV000509571 RCV000509574 RCV001823149 RCV002470935 RCV000850552 RCV000850553 RCV003152758	★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
FDXR-related disorder	Likely pathogenic; Pathogenic	rs778143816, rs760345680	RCV003956651 RCV003411472	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Multiple mitochondrial dysfunctions syndrome 9b	Pathogenic; Likely pathogenic	rs752001360, rs2509785660, rs2509788341, rs1323016653, rs760345680, rs1598515363, rs752675360	RCV004595665 RCV004595666 RCV004588573 RCV004595517 RCV004595518 RCV004595557 RCV004595586	★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Optic atrophy-ataxia-peripheral neuropathy-global developmental delay syndrome	Likely pathogenic	rs752675360	RCV001263152	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Phenylketonuria	Likely pathogenic	rs752675360	RCV006257331	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
Acute myeloid leukemia	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Auditory neuropathy	Conflicting classifications of pathogenicity	ClinVar Disgenet	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
AUDITORY NEUROPATHY AND OPTIC ATROPHY	—	Disgenet, HPO Disgenet, HPO	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholangiocarcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colon adenocarcinoma	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ferrodoxin Reductase (FDXR) Deficiency	Conflicting classifications of pathogenicity	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Benign; Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant lymphoma, large B-cell, diffuse	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Uncertain significance; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OPTIC ATROPHY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OPTIC ATROPHY, ATAXIA, PERIPHERAL NEUROPATHY, GLOBAL DEVELOPMENTAL DELAY SYNDROME	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thymoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine carcinosarcoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute Erythroblastic Leukemia	Erythroblastic Leukemia	BEFREE	28199114		★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	14618619		★☆☆☆☆ Found in Text Mining only
Acute monocytic leukemia	Monocytic Leukemia	BEFREE	19288261		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	29539651, 29776746, 30308546		★☆☆☆☆ Found in Text Mining only
Adrenocortical Carcinoma	Adrenocortical carcinoma	Pubtator	25691058	Associate	★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	14618619		★☆☆☆☆ Found in Text Mining only
Anaplasia	Anaplasia	BEFREE	30198788		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	16197474, 17996583, 19862939		★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial fibrillation	Pubtator	35003319	Associate	★☆☆☆☆ Found in Text Mining only
Auditory neuropathy	Auditory neuropathy	Pubtator	28965846	Associate	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
AUDITORY NEUROPATHY AND OPTIC ATROPHY	Auditory Neuropathy-Optic Atrophy Syndrome	UNIPROT_DG	28965846		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUDITORY NEUROPATHY AND OPTIC ATROPHY	Auditory Neuropathy-Optic Atrophy Syndrome	GENOMICS_ENGLAND_DG	28965846		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUDITORY NEUROPATHY AND OPTIC ATROPHY	Auditory Neuropathy-Optic Atrophy Syndrome	ORPHANET_DG	28965846		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUDITORY NEUROPATHY AND OPTIC ATROPHY	Auditory Neuropathy-Optic Atrophy Syndrome	CLINVAR_DG	28965846		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Auditory neuropathy-optic atrophy syndrome	Auditory Neuropathy-Optic Atrophy Syndrome	Orphanet			★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Breast adenocarcinoma	Breast Adenocarcinoma	BEFREE	28782465, 30245967		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	14692651, 15183541, 17036319, 17725099, 20387147, 22051041, 23941826, 24866720, 25481438, 25818003, 26842910, 27581212, 27758045, 28329693, 28478351, 28688213, 29257222, 29416762, 29606866, 29773888, 30140154, 30532538, 30537505, 30648523, 30844143, 31444414, 31660085, 8787680		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	1309222		★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	26814892, 36225932	Associate	★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	21289629		★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	14618619		★☆☆☆☆ Found in Text Mining only
Childhood asthma	Asthma	BEFREE	19862939		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	30532537		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	BEFREE	14559799		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	29340817		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	11590433	Associate	★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	30844728		★☆☆☆☆ Found in Text Mining only
Cushing Syndrome	Cushing`s Syndrome	BEFREE	29440375, 29574994		★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	BEFREE	29304089		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	30429496		★☆☆☆☆ Found in Text Mining only
Glaucoma, Open-Angle	Glaucoma	BEFREE	30198788		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	8787680		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	8787680		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	2294193		★☆☆☆☆ Found in Text Mining only
Hearing Loss Sensorineural	Hearing loss	Pubtator	33938912	Associate	★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	30844728		★☆☆☆☆ Found in Text Mining only
Hematologic Diseases	Hematologic disease	Pubtator	37676284	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	26492917	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary hemochromatosis	Hereditary Hemochromatosis	BEFREE	27105509		★☆☆☆☆ Found in Text Mining only
Hereditary motor and sensory neuropathy with optic atrophy (disorder)	Hereditary Motor And Sensory Neuropathy With Optic Atrophy	BEFREE	30250212		★☆☆☆☆ Found in Text Mining only
Hereditary Sensory and Autonomic Neuropathies	Hereditary sensory and autonomic neuropathy	Pubtator	28965846	Associate	★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	11775127		★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal Diseases	BEFREE	18511740		★☆☆☆☆ Found in Text Mining only
Iron Overload	Iron overload	Pubtator	22101253, 28965846	Associate	★☆☆☆☆ Found in Text Mining only
Iron Overload	Iron Overload	BEFREE	28965846		★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable Bowel Syndrome	BEFREE	18511740		★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	11172691, 15878840, 28927751		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	19288261, 28042875		★☆☆☆☆ Found in Text Mining only
Leukopenia	Leukopenia	BEFREE	29071720		★☆☆☆☆ Found in Text Mining only
Lipoid congenital adrenal hyperplasia	Congenital lipoid adrenal hyperplasia	Pubtator	1661294	Associate	★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	15962362, 30850969		★☆☆☆☆ Found in Text Mining only
Low Tension Glaucoma	Low Tension Glaucoma	BEFREE	20705341		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	21489244	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	14692651, 15183541, 17036319, 17725099, 20387147, 22051041, 23941826, 24866720, 25481438, 25818003, 26842910, 27581212, 27758045, 28329693, 28478351, 28688213, 29257222, 29416762, 29606866, 29773888, 30140154, 30532538, 30537505, 30648523, 30844143, 31444414, 31660085, 8787680		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	31173853		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	16406853, 20444629, 23852809, 28815573, 29795767, 30054832		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	30532537		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	27769887		★☆☆☆☆ Found in Text Mining only
Milroy Disease	Milroy Disease	BEFREE	28199114		★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	28965846	Associate	★☆☆☆☆ Found in Text Mining only
MOHR-TRANEBJAERG SYNDROME	MOHR-TRANEBJAERG SYNDROME	BEFREE	31411235		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	30701416		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	38178798	Associate	★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia	Myeloid Leukemia	BEFREE	28529625		★☆☆☆☆ Found in Text Mining only
Myopathy	Myopathy	BEFREE	29020356		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	16528528, 19067123, 27250110, 27943612, 28115844, 28199114, 28243082, 29179722, 29519418, 29618203, 29694920, 29719378, 29958912, 30251407, 30349304, 31095914, 31132609, 31141733, 31332290, 31408695, 31465208, 31495855		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	28886198		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	28886198	Associate	★☆☆☆☆ Found in Text Mining only
Neuropathy	Neuropathy	BEFREE	28965846		★☆☆☆☆ Found in Text Mining only
Nystagmus	Nystagmus	HPO_DG			★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	10954027, 11808891		★☆☆☆☆ Found in Text Mining only
Ocular Hypertension	Ocular Hypertension	BEFREE	30198788		★☆☆☆☆ Found in Text Mining only
Optic Atrophy	Optic atrophy	Pubtator	28965846, 33938912	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Optic Atrophy	Optic Atrophy	BEFREE	29040572		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Optic Atrophy	Optic Atrophy	HPO_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Optic atrophy-ataxia-peripheral neuropathy-global developmental delay syndrome	Optic Atrophy-Ataxia-Peripheral Neuropathy-Global Developmental Delay Syndrome	Orphanet			★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Parkinson Disease	Parkinson disease	BEFREE	31429849		★☆☆☆☆ Found in Text Mining only
Pediatric Obesity	Childhood obesity	BEFREE	11808891		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	37445796	Associate	★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	BEFREE	29304089		★☆☆☆☆ Found in Text Mining only
Retinitis Pigmentosa	Retinitis pigmentosa	Pubtator	22436252	Associate	★☆☆☆☆ Found in Text Mining only
Rod-Cone Dystrophy	Rod-cone dystrophy	HPO_DG			★☆☆☆☆ Found in Text Mining only
Rotator cuff syndrome	Rotator cuff syndrome	BEFREE	28483431		★☆☆☆☆ Found in Text Mining only
Schwartz-Jampel Syndrome	Schwartz-Jampel Syndrome	BEFREE	21342226		★☆☆☆☆ Found in Text Mining only
Secondary malignant neoplasm of colon and/or rectum	Colorectal Neoplasms	BEFREE	16528528		★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	1310401, 15816546		★☆☆☆☆ Found in Text Mining only
Stevens-Johnson Syndrome	Stevens-Johnson Syndrome	BEFREE	21342226		★☆☆☆☆ Found in Text Mining only
Stevens-Johnson Syndrome Toxic Epidermal Necrolysis Spectrum	Stevens-Johnson Syndrome	BEFREE	28483310		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	28498440, 31173853		★☆☆☆☆ Found in Text Mining only
Toxic Epidermal Necrolysis	Stevens-Johnson Syndrome	BEFREE	21342226		★☆☆☆☆ Found in Text Mining only