Gene Gene information from NCBI Gene database.
Entrez ID 223082
Gene name Zinc and ring finger 2
Gene symbol ZNRF2
Synonyms (NCBI Gene)
RNF202
Chromosome 7
Chromosome location 7p14.3
miRNA miRNA information provided by mirtarbase database.
1148
miRTarBase ID miRNA Experiments Reference
MIRT027035 hsa-miR-103a-3p Sequencing 20371350
MIRT320640 hsa-miR-4274 HITS-CLIP 21572407
MIRT320644 hsa-miR-4519 HITS-CLIP 21572407
MIRT221663 hsa-miR-4328 HITS-CLIP 21572407
MIRT504958 hsa-miR-548aj-5p HITS-CLIP 21572407
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
32
GO ID Ontology Definition Evidence Reference
GO:0001650 Component Fibrillar center IDA
GO:0005654 Component Nucleoplasm IDA
GO:0005737 Component Cytoplasm IBA
GO:0005737 Component Cytoplasm IDA 22797923, 38360932
GO:0005737 Component Cytoplasm IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
612061 22316 ENSG00000180233
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q8NHG8
Protein name E3 ubiquitin-protein ligase ZNRF2 (EC 2.3.2.27) (Protein Ells2) (RING finger protein 202) (RING-type E3 ubiquitin transferase ZNRF2) (Zinc/RING finger protein 2)
Protein function E3 ubiquitin-protein ligase that plays a role in the establishment and maintenance of neuronal transmission and plasticity. Ubiquitinates the Na(+)/K(+) ATPase alpha-1 subunit/ATP1A1 and thereby influences its endocytosis and/or degradation (Pub
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13639 zf-RING_2 197 238 Ring finger domain Domain
Tissue specificity TISSUE SPECIFICITY: Highly expressed in the brain, with higher expression during development than in adult. Expressed also in mammary glands, testis, colon and kidney. {ECO:0000269|PubMed:14561866}.
Sequence
MGAKQSGPAAANGRTRAYSGSDLPSSSSGGANGTAGGGGGARAAAAGRFPAQVPSAHQPS
ASGGAAAAAAAPAAPAAPRSRSLGGAVGSVASGARAAQSPFSIPNSSSGPYGSQDSVHSS
PEDGGGGRDRPVGGSPGGPRLVIGSLPAHLSPHMFGGFKCPVCSKFVSSDEMDLHLVMCL
TKPRITYNEDVLSKDAGECAICLEELQQGDTIARLPCLCIYHKGCIDEWFEVNRSCPEHP
SD
Sequence length 242
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Antigen processing: Ubiquitination & Proteasome degradation
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
1
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
COLORECTAL CANCER GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Carcinogenesis Carcinogenesis Pubtator 27775798 Associate
★☆☆☆☆
Found in Text Mining only
Carcinoma Squamous Cell Squamous cell carcinoma Pubtator 35779918 Associate
★☆☆☆☆
Found in Text Mining only
Non-Small Cell Lung Carcinoma Lung carcinoma BEFREE 27775798
★☆☆☆☆
Found in Text Mining only
Osteosarcoma Osteosarcoma BEFREE 28416774
★☆☆☆☆
Found in Text Mining only
Osteosarcoma Osteosarcoma Pubtator 28416774 Associate
★☆☆☆☆
Found in Text Mining only
Papillary thyroid carcinoma Papillary thyroid carcinoma BEFREE 30811764
★☆☆☆☆
Found in Text Mining only