Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	222698
Gene name	NFKB activating protein like
Gene symbol	NKAPL
Synonyms (NCBI Gene)	C6orf194bA424I5.1
Chromosome	6
Chromosome location	6p22.1

Show/Hide all (55)

miRTarBase ID	miRNA	Experiments	Reference
MIRT663507	hsa-miR-873-3p	HITS-CLIP	23313552
MIRT684694	hsa-miR-6867-5p	HITS-CLIP	23313552
MIRT663506	hsa-miR-3672	HITS-CLIP	23313552
MIRT663505	hsa-miR-6864-3p	HITS-CLIP	23313552
MIRT663504	hsa-miR-6818-5p	HITS-CLIP	23313552
MIRT684693	hsa-miR-574-5p	HITS-CLIP	23313552
MIRT663507	hsa-miR-873-3p	HITS-CLIP	23824327
MIRT663506	hsa-miR-3672	HITS-CLIP	23824327
MIRT663505	hsa-miR-6864-3p	HITS-CLIP	23824327
MIRT663504	hsa-miR-6818-5p	HITS-CLIP	23824327
MIRT663506	hsa-miR-3672	HITS-CLIP	27418678
MIRT663506	hsa-miR-3672	HITS-CLIP	27418678
MIRT663506	hsa-miR-3672	HITS-CLIP	27418678
MIRT663506	hsa-miR-3672	HITS-CLIP	27418678
MIRT684693	hsa-miR-574-5p	HITS-CLIP	27418678
MIRT684693	hsa-miR-574-5p	HITS-CLIP	27418678
MIRT684693	hsa-miR-574-5p	HITS-CLIP	27418678
MIRT684693	hsa-miR-574-5p	HITS-CLIP	27418678
MIRT663504	hsa-miR-6818-5p	HITS-CLIP	27418678
MIRT663504	hsa-miR-6818-5p	HITS-CLIP	27418678
MIRT663504	hsa-miR-6818-5p	HITS-CLIP	27418678
MIRT663504	hsa-miR-6818-5p	HITS-CLIP	27418678
MIRT663505	hsa-miR-6864-3p	HITS-CLIP	27418678
MIRT663505	hsa-miR-6864-3p	HITS-CLIP	27418678
MIRT663505	hsa-miR-6864-3p	HITS-CLIP	27418678
MIRT663505	hsa-miR-6864-3p	HITS-CLIP	27418678
MIRT684694	hsa-miR-6867-5p	HITS-CLIP	27418678
MIRT684694	hsa-miR-6867-5p	HITS-CLIP	27418678
MIRT684694	hsa-miR-6867-5p	HITS-CLIP	27418678
MIRT684694	hsa-miR-6867-5p	HITS-CLIP	27418678
MIRT663507	hsa-miR-873-3p	HITS-CLIP	27418678
MIRT663507	hsa-miR-873-3p	HITS-CLIP	27418678
MIRT663507	hsa-miR-873-3p	HITS-CLIP	27418678
MIRT663507	hsa-miR-873-3p	HITS-CLIP	27418678
MIRT663507	hsa-miR-873-3p	HITS-CLIP	23313552
MIRT684694	hsa-miR-6867-5p	HITS-CLIP	23313552
MIRT663506	hsa-miR-3672	HITS-CLIP	23313552
MIRT663505	hsa-miR-6864-3p	HITS-CLIP	23313552
MIRT663504	hsa-miR-6818-5p	HITS-CLIP	23313552
MIRT684693	hsa-miR-574-5p	HITS-CLIP	23313552
MIRT663507	hsa-miR-873-3p	HITS-CLIP	23824327
MIRT663506	hsa-miR-3672	HITS-CLIP	23824327
MIRT663505	hsa-miR-6864-3p	HITS-CLIP	23824327
MIRT663504	hsa-miR-6818-5p	HITS-CLIP	23824327
MIRT1186069	hsa-miR-19a	CLIP-seq
MIRT1186070	hsa-miR-19b	CLIP-seq
MIRT1186071	hsa-miR-3074-5p	CLIP-seq
MIRT1186072	hsa-miR-320e	CLIP-seq
MIRT1186073	hsa-miR-3613-3p	CLIP-seq
MIRT1186074	hsa-miR-370	CLIP-seq
MIRT1186075	hsa-miR-4282	CLIP-seq
MIRT1186076	hsa-miR-4744	CLIP-seq
MIRT1186077	hsa-miR-495	CLIP-seq
MIRT1186078	hsa-miR-548aa	CLIP-seq
MIRT2283122	hsa-miR-4772-3p	CLIP-seq

Show/Hide all (7)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003682	Function	Chromatin binding	IEA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0007283	Process	Spermatogenesis	IEA
GO:0010468	Process	Regulation of gene expression	IBA
GO:0030154	Process	Cell differentiation	IEA

MIM	HGNC	e!Ensembl
HGNC	N/A	HGNC

Q5M9Q1

Protein name

NKAP-like protein

Protein function

Transcriptional repressor of Notch-mediated signaling. Required for spermatogenesis.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF15692	NKAP	109 → 204		Family
PF06047	Nkap_C	293 → 394	NF-kappa-B-activating protein C-terminal domain	Domain

Sequence

MPPVSRSSYSEDIVGSRRRRRSSSGSPPSPQSRCSSWDGCSRSHSRGREGLRPPWSELDV
GALYPFSRSGSRGRLPRFRNYAFASSWSTSYSGYRYHRHCYAEERQSAEDYEKEESHRQR
RLKERERIGELGAPEVWGPSPKFPQLDSDEHTPVEDEEEVTHQKSSSSDSNSEEHRKKKT
SRSRNKKKRKNKSSKRKHRKYSDSDSNSESDTNSDSDDDKKRVKAKKKKKKKKHKTKKKK
NKKTKKESSDSSCKDSEEDLSEATWMEQPNVADTMDLIGPEAPIIHTSQDEKPLKYGHAL
LPGEGAAMAEYVKAGKRIPRRGEIGLTSEEIGSFECSGYVMSGSRHRRMEAVRLRKENQI
YSADEKRALASFNQEERRKRESKILASFREMVHKKTKEKDDK

Sequence length

402

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (3)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (9)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	23223422	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	29353445		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	29353445		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	GWASDB_DG	19503088		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	22037552, 24972756, 26297123		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	GWASDB_DG	22037552		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	CTD_human_DG	22037552		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	GWASCAT_DG	22037552		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomach Neoplasms	Stomach neoplasms	Pubtator	29923336	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

NKAPL (NFKB activating protein like)