Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	222487
Gene name	Adhesion G protein-coupled receptor G3
Gene symbol	ADGRG3
Synonyms (NCBI Gene)	GPR97PB99PGR26
Chromosome	16
Chromosome location	16q21

Show/Hide all (15)

miRTarBase ID	miRNA	Experiments	Reference
MIRT740516	hsa-miR-449b-3p	HITS-CLIP	19536157
MIRT740517	hsa-miR-4691-3p	HITS-CLIP	19536157
MIRT740518	hsa-miR-5196-3p	HITS-CLIP	19536157
MIRT740519	hsa-miR-1470	HITS-CLIP	19536157
MIRT740520	hsa-miR-4667-3p	HITS-CLIP	19536157
MIRT740521	hsa-miR-3183	HITS-CLIP	19536157
MIRT740522	hsa-miR-4723-3p	HITS-CLIP	19536157
MIRT740523	hsa-miR-6769b-3p	HITS-CLIP	19536157
MIRT740524	hsa-miR-4469	HITS-CLIP	19536157
MIRT740525	hsa-miR-7113-3p	HITS-CLIP	19536157
MIRT740526	hsa-miR-4287	HITS-CLIP	19536157
MIRT740527	hsa-miR-4685-3p	HITS-CLIP	19536157
MIRT740528	hsa-miR-2355-5p	HITS-CLIP	19536157
MIRT740529	hsa-miR-7111-3p	HITS-CLIP	19536157
MIRT740530	hsa-miR-6867-3p	HITS-CLIP	19536157

Show/Hide all (25)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004888	Function	Transmembrane signaling receptor activity	IEA
GO:0004930	Function	G protein-coupled receptor activity	IBA
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0004930	Function	G protein-coupled receptor activity	IMP	33408414
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	IMP	22575658
GO:0005886	Component	Plasma membrane	TAS
GO:0007165	Process	Signal transduction	IEA
GO:0007166	Process	Cell surface receptor signaling pathway	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IBA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IDA	22575658
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007193	Process	Adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway	IDA	33408414
GO:0007193	Process	Adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway	IDA	33408414
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	TAS	15203201
GO:0030183	Process	B cell differentiation	IEA
GO:0030183	Process	B cell differentiation	ISS
GO:0030334	Process	Regulation of cell migration	IMP	24178298
GO:0032792	Process	Negative regulation of CREB transcription factor activity	ISS
GO:0035579	Component	Specific granule membrane	TAS
GO:1901223	Process	Negative regulation of non-canonical NF-kappaB signal transduction	IEA
GO:1901223	Process	Negative regulation of non-canonical NF-kappaB signal transduction	ISS

MIM	HGNC	e!Ensembl
618441	13728	ENSG00000182885

Q86Y34

Protein name

Adhesion G protein-coupled receptor G3 (G-protein coupled receptor 97) [Cleaved into: Adhesion G-protein coupled receptor G3, N-terminal fragment (ADGRG3 N-terminal fragment); Adhesion G-protein coupled receptor G3, C-terminal fragment (ADGRG3 C-terminal

Protein function

Adhesion G-protein coupled receptor (aGPCR) for glucocorticoid hormones such as cortisol, cortisone and 11-deoxycortisol (PubMed:33408414). Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding protei

PDB

7D76 , 7D77 , 7QU8

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01825	GPS	213 → 255	GPCR proteolysis site, GPS, motif	Motif
PF00002	7tm_2	265 → 517	7 transmembrane receptor (Secretin family)	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in cultured primary dermal lymphatic endothelial cells (PubMed:24178298). Highly expressed in polymorphonuclear cells (PMNs) including neutrophilic, eosinophilic, and basophilic granulocytes (PubMed:30559745). {ECO:0000269|Pu

Sequence

MATPRGLGALLLLLLLPTSGQEKPTEGPRNTCLGSNNMYDIFNLNDKALCFTKCRQSGSD
SCNVENLQRYWLNYEAHLMKEGLTQKVNTPFLKALVQNLSTNTAEDFYFSLEPSQVPRQV
MKDEDKPPDRVRLPKSLFRSLPGNRSVVRLAVTILDIGPGTLFKGPRLGLGDGSGVLNNR
LVGLSVGQMHVTKLAEPLEIVFSHQRPPPNMTLTCVFWDVTKGTTGDWSSEGCSTEVRPE
GTVCCCDHLTFFALLLRPTLDQSTVHILTRISQAGCGVSMIFLAFTIILYAFLRLSRERF
KSEDAPKIHVALGGSLFLLNLAFLVNVGSGSKGSDAACWARGAVFHYFLLCAFTWMGLEA
FHLYLLAVRVFNTYFGHYFLKLSLVGWGLPALMVIGTGSANSYGLYTIRDRENRTSLELC
WFREGTTMYALYITVHGYFLITFLFGMVVLALVVWKIFTLSRATAVKERGKNRKKVLTLL
GLSSLVGVTWGLAIFTPLGLSTVYIFALFNSLQGVFICCWFTILYLPSQSTTVSSSTARL
DQAHSASQE

Sequence length

549

Interactions

View interactions

	Reactome
			Neutrophil degranulation

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
PROSTATE CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (6)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute Kidney Tubular Necrosis	Renal tubular necrosis	BEFREE	29531097		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	29860267		★★★★★ ★☆☆☆☆ Found in Text Mining only
CNS disorder	CNS Disorder	BEFREE	29860267		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	Pubtator	34555062	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gingival Diseases	Gingival diseases	Pubtator	31743516	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	31153896	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

ADGRG3 (adhesion G protein-coupled receptor G3)