FCN2 (ficolin 2)

Gene

• Entrez ID: 2220
• Gene name: Ficolin 2
• Gene symbol: FCN2
• Synonyms (NCBI Gene): EBP-37, FCNL, P35, ficolin-2
• Chromosome: 9
• Chromosome location: 9q34.3
• Summary: The product of this gene belongs to the ficolin family of proteins. This family is characterized by the presence of a leader peptide, a short N-terminal segment, followed by a collagen-like region, and a C-terminal fibrinogen-like domain. This gene is pre

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT029624	hsa-miR-26b-5p	Microarray	19088304
MIRT610902	hsa-miR-8485	HITS-CLIP	23824327
MIRT610901	hsa-miR-501-3p	HITS-CLIP	23824327
MIRT610900	hsa-miR-502-3p	HITS-CLIP	23824327
MIRT614115	hsa-miR-764	HITS-CLIP	23824327
MIRT610899	hsa-miR-8064	HITS-CLIP	23824327
MIRT610898	hsa-miR-5589-3p	HITS-CLIP	23824327
MIRT610902	hsa-miR-8485	HITS-CLIP	23824327
MIRT610901	hsa-miR-501-3p	HITS-CLIP	23824327
MIRT610900	hsa-miR-502-3p	HITS-CLIP	23824327
MIRT614115	hsa-miR-764	HITS-CLIP	23824327
MIRT610899	hsa-miR-8064	HITS-CLIP	23824327
MIRT610898	hsa-miR-5589-3p	HITS-CLIP	23824327
MIRT614114	hsa-miR-3665	HITS-CLIP	23824327
MIRT610902	hsa-miR-8485	HITS-CLIP	23824327
MIRT610901	hsa-miR-501-3p	HITS-CLIP	23824327
MIRT610900	hsa-miR-502-3p	HITS-CLIP	23824327
MIRT614115	hsa-miR-764	HITS-CLIP	23824327
MIRT610899	hsa-miR-8064	HITS-CLIP	23824327
MIRT610898	hsa-miR-5589-3p	HITS-CLIP	23824327
MIRT614114	hsa-miR-3665	HITS-CLIP	23824327
MIRT610902	hsa-miR-8485	HITS-CLIP	23824327
MIRT610901	hsa-miR-501-3p	HITS-CLIP	23824327
MIRT610900	hsa-miR-502-3p	HITS-CLIP	23824327
MIRT614115	hsa-miR-764	HITS-CLIP	23824327
MIRT610899	hsa-miR-8064	HITS-CLIP	23824327
MIRT610898	hsa-miR-5589-3p	HITS-CLIP	23824327
MIRT610902	hsa-miR-8485	HITS-CLIP	23824327
MIRT610901	hsa-miR-501-3p	HITS-CLIP	23824327
MIRT610900	hsa-miR-502-3p	HITS-CLIP	23824327
MIRT614115	hsa-miR-764	HITS-CLIP	23824327
MIRT610899	hsa-miR-8064	HITS-CLIP	23824327
MIRT610898	hsa-miR-5589-3p	HITS-CLIP	23824327
MIRT610902	hsa-miR-8485	HITS-CLIP	23824327
MIRT610901	hsa-miR-501-3p	HITS-CLIP	23824327
MIRT610900	hsa-miR-502-3p	HITS-CLIP	23824327
MIRT614115	hsa-miR-764	HITS-CLIP	23824327
MIRT610899	hsa-miR-8064	HITS-CLIP	23824327
MIRT610898	hsa-miR-5589-3p	HITS-CLIP	23824327
MIRT614114	hsa-miR-3665	HITS-CLIP	23824327
MIRT610902	hsa-miR-8485	HITS-CLIP	23824327
MIRT610901	hsa-miR-501-3p	HITS-CLIP	23824327
MIRT610900	hsa-miR-502-3p	HITS-CLIP	23824327
MIRT614115	hsa-miR-764	HITS-CLIP	23824327
MIRT610899	hsa-miR-8064	HITS-CLIP	23824327
MIRT610898	hsa-miR-5589-3p	HITS-CLIP	23824327
MIRT614114	hsa-miR-3665	HITS-CLIP	23824327
MIRT610902	hsa-miR-8485	HITS-CLIP	23824327
MIRT610901	hsa-miR-501-3p	HITS-CLIP	23824327
MIRT610900	hsa-miR-502-3p	HITS-CLIP	23824327
MIRT614115	hsa-miR-764	HITS-CLIP	23824327
MIRT610899	hsa-miR-8064	HITS-CLIP	23824327
MIRT610898	hsa-miR-5589-3p	HITS-CLIP	23824327
MIRT610902	hsa-miR-8485	HITS-CLIP	23824327
MIRT610901	hsa-miR-501-3p	HITS-CLIP	23824327
MIRT610900	hsa-miR-502-3p	HITS-CLIP	23824327
MIRT614115	hsa-miR-764	HITS-CLIP	23824327
MIRT610898	hsa-miR-5589-3p	HITS-CLIP	23824327
MIRT610902	hsa-miR-8485	HITS-CLIP	23824327
MIRT610901	hsa-miR-501-3p	HITS-CLIP	23824327
MIRT610900	hsa-miR-502-3p	HITS-CLIP	23824327
MIRT614115	hsa-miR-764	HITS-CLIP	23824327
MIRT610899	hsa-miR-8064	HITS-CLIP	23824327
MIRT610898	hsa-miR-5589-3p	HITS-CLIP	23824327
MIRT610902	hsa-miR-8485	HITS-CLIP	23824327
MIRT610901	hsa-miR-501-3p	HITS-CLIP	23824327
MIRT610900	hsa-miR-502-3p	HITS-CLIP	23824327
MIRT614115	hsa-miR-764	HITS-CLIP	23824327
MIRT610899	hsa-miR-8064	HITS-CLIP	23824327
MIRT610898	hsa-miR-5589-3p	HITS-CLIP	23824327
MIRT614114	hsa-miR-3665	HITS-CLIP	23824327
MIRT610902	hsa-miR-8485	HITS-CLIP	23824327
MIRT610901	hsa-miR-501-3p	HITS-CLIP	23824327
MIRT610900	hsa-miR-502-3p	HITS-CLIP	23824327
MIRT614115	hsa-miR-764	HITS-CLIP	23824327
MIRT610899	hsa-miR-8064	HITS-CLIP	23824327
MIRT610898	hsa-miR-5589-3p	HITS-CLIP	23824327
MIRT614114	hsa-miR-3665	HITS-CLIP	23824327
MIRT610902	hsa-miR-8485	HITS-CLIP	23824327
MIRT610901	hsa-miR-501-3p	HITS-CLIP	23824327
MIRT610900	hsa-miR-502-3p	HITS-CLIP	23824327
MIRT614115	hsa-miR-764	HITS-CLIP	23824327
MIRT610899	hsa-miR-8064	HITS-CLIP	23824327
MIRT610898	hsa-miR-5589-3p	HITS-CLIP	23824327
MIRT614114	hsa-miR-3665	HITS-CLIP	23824327
MIRT610902	hsa-miR-8485	HITS-CLIP	23824327
MIRT610901	hsa-miR-501-3p	HITS-CLIP	23824327
MIRT610900	hsa-miR-502-3p	HITS-CLIP	23824327
MIRT610899	hsa-miR-8064	HITS-CLIP	23824327
MIRT610898	hsa-miR-5589-3p	HITS-CLIP	23824327
MIRT610902	hsa-miR-8485	HITS-CLIP	23824327
MIRT610901	hsa-miR-501-3p	HITS-CLIP	23824327
MIRT610900	hsa-miR-502-3p	HITS-CLIP	23824327
MIRT614115	hsa-miR-764	HITS-CLIP	23824327
MIRT610899	hsa-miR-8064	HITS-CLIP	23824327
MIRT610898	hsa-miR-5589-3p	HITS-CLIP	23824327
MIRT614114	hsa-miR-3665	HITS-CLIP	23824327
MIRT610902	hsa-miR-8485	HITS-CLIP	23824327
MIRT610901	hsa-miR-501-3p	HITS-CLIP	23824327
MIRT610900	hsa-miR-502-3p	HITS-CLIP	23824327
MIRT614115	hsa-miR-764	HITS-CLIP	23824327
MIRT610899	hsa-miR-8064	HITS-CLIP	23824327
MIRT610898	hsa-miR-5589-3p	HITS-CLIP	23824327
MIRT614114	hsa-miR-3665	HITS-CLIP	23824327
MIRT610902	hsa-miR-8485	HITS-CLIP	23824327
MIRT610901	hsa-miR-501-3p	HITS-CLIP	23824327
MIRT610900	hsa-miR-502-3p	HITS-CLIP	23824327
MIRT614115	hsa-miR-764	HITS-CLIP	23824327
MIRT610899	hsa-miR-8064	HITS-CLIP	23824327
MIRT610898	hsa-miR-5589-3p	HITS-CLIP	23824327
MIRT614114	hsa-miR-3665	HITS-CLIP	23824327
MIRT610902	hsa-miR-8485	HITS-CLIP	23824327
MIRT610901	hsa-miR-501-3p	HITS-CLIP	23824327
MIRT610900	hsa-miR-502-3p	HITS-CLIP	23824327
MIRT614115	hsa-miR-764	HITS-CLIP	23824327
MIRT610899	hsa-miR-8064	HITS-CLIP	23824327
MIRT610898	hsa-miR-5589-3p	HITS-CLIP	23824327
MIRT614114	hsa-miR-3665	HITS-CLIP	23824327
MIRT610902	hsa-miR-8485	HITS-CLIP	23824327
MIRT610901	hsa-miR-501-3p	HITS-CLIP	23824327
MIRT610900	hsa-miR-502-3p	HITS-CLIP	23824327
MIRT610899	hsa-miR-8064	HITS-CLIP	23824327
MIRT610898	hsa-miR-5589-3p	HITS-CLIP	23824327
MIRT610902	hsa-miR-8485	HITS-CLIP	23824327
MIRT610901	hsa-miR-501-3p	HITS-CLIP	23824327
MIRT610900	hsa-miR-502-3p	HITS-CLIP	23824327
MIRT614115	hsa-miR-764	HITS-CLIP	23824327
MIRT610899	hsa-miR-8064	HITS-CLIP	23824327
MIRT610898	hsa-miR-5589-3p	HITS-CLIP	23824327
MIRT614114	hsa-miR-3665	HITS-CLIP	23824327
MIRT610902	hsa-miR-8485	HITS-CLIP	23824327
MIRT610901	hsa-miR-501-3p	HITS-CLIP	23824327
MIRT610900	hsa-miR-502-3p	HITS-CLIP	23824327
MIRT610899	hsa-miR-8064	HITS-CLIP	23824327
MIRT610898	hsa-miR-5589-3p	HITS-CLIP	23824327
MIRT610902	hsa-miR-8485	HITS-CLIP	23824327
MIRT610901	hsa-miR-501-3p	HITS-CLIP	23824327
MIRT610900	hsa-miR-502-3p	HITS-CLIP	23824327
MIRT614115	hsa-miR-764	HITS-CLIP	23824327
MIRT610899	hsa-miR-8064	HITS-CLIP	23824327
MIRT610898	hsa-miR-5589-3p	HITS-CLIP	23824327
MIRT610902	hsa-miR-8485	HITS-CLIP	23824327
MIRT610901	hsa-miR-501-3p	HITS-CLIP	23824327
MIRT610900	hsa-miR-502-3p	HITS-CLIP	23824327
MIRT614115	hsa-miR-764	HITS-CLIP	23824327
MIRT610899	hsa-miR-8064	HITS-CLIP	23824327
MIRT610898	hsa-miR-5589-3p	HITS-CLIP	23824327
MIRT614114	hsa-miR-3665	HITS-CLIP	23824327
MIRT610902	hsa-miR-8485	HITS-CLIP	23824327
MIRT610901	hsa-miR-501-3p	HITS-CLIP	23824327
MIRT610900	hsa-miR-502-3p	HITS-CLIP	23824327
MIRT614115	hsa-miR-764	HITS-CLIP	23824327
MIRT610899	hsa-miR-8064	HITS-CLIP	23824327
MIRT610898	hsa-miR-5589-3p	HITS-CLIP	23824327
MIRT614114	hsa-miR-3665	HITS-CLIP	23824327
MIRT610902	hsa-miR-8485	HITS-CLIP	23824327
MIRT610901	hsa-miR-501-3p	HITS-CLIP	23824327
MIRT610900	hsa-miR-502-3p	HITS-CLIP	23824327
MIRT614115	hsa-miR-764	HITS-CLIP	23824327
MIRT610899	hsa-miR-8064	HITS-CLIP	23824327
MIRT610898	hsa-miR-5589-3p	HITS-CLIP	23824327
MIRT610902	hsa-miR-8485	HITS-CLIP	23824327
MIRT610901	hsa-miR-501-3p	HITS-CLIP	23824327
MIRT610900	hsa-miR-502-3p	HITS-CLIP	23824327
MIRT614115	hsa-miR-764	HITS-CLIP	23824327
MIRT610899	hsa-miR-8064	HITS-CLIP	23824327
MIRT610898	hsa-miR-5589-3p	HITS-CLIP	23824327
MIRT610902	hsa-miR-8485	HITS-CLIP	23824327
MIRT610901	hsa-miR-501-3p	HITS-CLIP	23824327
MIRT610900	hsa-miR-502-3p	HITS-CLIP	23824327
MIRT614115	hsa-miR-764	HITS-CLIP	23824327
MIRT610899	hsa-miR-8064	HITS-CLIP	23824327
MIRT610898	hsa-miR-5589-3p	HITS-CLIP	23824327
MIRT614114	hsa-miR-3665	HITS-CLIP	23824327
MIRT610902	hsa-miR-8485	HITS-CLIP	23824327
MIRT610901	hsa-miR-501-3p	HITS-CLIP	23824327
MIRT610900	hsa-miR-502-3p	HITS-CLIP	23824327
MIRT614115	hsa-miR-764	HITS-CLIP	23824327
MIRT610899	hsa-miR-8064	HITS-CLIP	23824327
MIRT610898	hsa-miR-5589-3p	HITS-CLIP	23824327
MIRT614114	hsa-miR-3665	HITS-CLIP	23824327
MIRT610902	hsa-miR-8485	HITS-CLIP	23824327
MIRT610901	hsa-miR-501-3p	HITS-CLIP	23824327
MIRT610900	hsa-miR-502-3p	HITS-CLIP	23824327
MIRT614115	hsa-miR-764	HITS-CLIP	23824327
MIRT610899	hsa-miR-8064	HITS-CLIP	23824327
MIRT610898	hsa-miR-5589-3p	HITS-CLIP	23824327
MIRT610902	hsa-miR-8485	HITS-CLIP	23824327
MIRT610901	hsa-miR-501-3p	HITS-CLIP	23824327
MIRT610900	hsa-miR-502-3p	HITS-CLIP	23824327
MIRT614115	hsa-miR-764	HITS-CLIP	23824327
MIRT610898	hsa-miR-5589-3p	HITS-CLIP	23824327
MIRT610902	hsa-miR-8485	HITS-CLIP	23824327
MIRT610901	hsa-miR-501-3p	HITS-CLIP	23824327
MIRT610900	hsa-miR-502-3p	HITS-CLIP	23824327
MIRT614115	hsa-miR-764	HITS-CLIP	23824327
MIRT610899	hsa-miR-8064	HITS-CLIP	23824327
MIRT610898	hsa-miR-5589-3p	HITS-CLIP	23824327
MIRT610902	hsa-miR-8485	HITS-CLIP	23824327
MIRT610901	hsa-miR-501-3p	HITS-CLIP	23824327
MIRT610900	hsa-miR-502-3p	HITS-CLIP	23824327
MIRT614115	hsa-miR-764	HITS-CLIP	23824327
MIRT610899	hsa-miR-8064	HITS-CLIP	23824327
MIRT610898	hsa-miR-5589-3p	HITS-CLIP	23824327
MIRT614114	hsa-miR-3665	HITS-CLIP	23824327
MIRT610902	hsa-miR-8485	HITS-CLIP	23824327
MIRT610901	hsa-miR-501-3p	HITS-CLIP	23824327
MIRT610900	hsa-miR-502-3p	HITS-CLIP	23824327
MIRT614115	hsa-miR-764	HITS-CLIP	23824327
MIRT610899	hsa-miR-8064	HITS-CLIP	23824327
MIRT610898	hsa-miR-5589-3p	HITS-CLIP	23824327
MIRT614114	hsa-miR-3665	HITS-CLIP	23824327
MIRT610902	hsa-miR-8485	HITS-CLIP	23824327
MIRT610901	hsa-miR-501-3p	HITS-CLIP	23824327
MIRT610900	hsa-miR-502-3p	HITS-CLIP	23824327
MIRT614115	hsa-miR-764	HITS-CLIP	23824327
MIRT610899	hsa-miR-8064	HITS-CLIP	23824327
MIRT610898	hsa-miR-5589-3p	HITS-CLIP	23824327
MIRT614114	hsa-miR-3665	HITS-CLIP	23824327
MIRT610902	hsa-miR-8485	HITS-CLIP	23824327
MIRT610901	hsa-miR-501-3p	HITS-CLIP	23824327
MIRT610900	hsa-miR-502-3p	HITS-CLIP	23824327
MIRT610899	hsa-miR-8064	HITS-CLIP	23824327
MIRT610898	hsa-miR-5589-3p	HITS-CLIP	23824327
MIRT610902	hsa-miR-8485	HITS-CLIP	23824327
MIRT610901	hsa-miR-501-3p	HITS-CLIP	23824327
MIRT610900	hsa-miR-502-3p	HITS-CLIP	23824327
MIRT614115	hsa-miR-764	HITS-CLIP	23824327
MIRT610899	hsa-miR-8064	HITS-CLIP	23824327
MIRT610898	hsa-miR-5589-3p	HITS-CLIP	23824327
MIRT614114	hsa-miR-3665	HITS-CLIP	23824327
MIRT610902	hsa-miR-8485	HITS-CLIP	23824327
MIRT610901	hsa-miR-501-3p	HITS-CLIP	23824327
MIRT610900	hsa-miR-502-3p	HITS-CLIP	23824327
MIRT614115	hsa-miR-764	HITS-CLIP	23824327
MIRT610899	hsa-miR-8064	HITS-CLIP	23824327
MIRT610898	hsa-miR-5589-3p	HITS-CLIP	23824327
MIRT614114	hsa-miR-3665	HITS-CLIP	23824327
MIRT610902	hsa-miR-8485	HITS-CLIP	23824327
MIRT610901	hsa-miR-501-3p	HITS-CLIP	23824327
MIRT610900	hsa-miR-502-3p	HITS-CLIP	23824327
MIRT614115	hsa-miR-764	HITS-CLIP	23824327
MIRT610899	hsa-miR-8064	HITS-CLIP	23824327
MIRT610898	hsa-miR-5589-3p	HITS-CLIP	23824327
MIRT614114	hsa-miR-3665	HITS-CLIP	23824327
MIRT610902	hsa-miR-8485	HITS-CLIP	23824327
MIRT610901	hsa-miR-501-3p	HITS-CLIP	23824327
MIRT610900	hsa-miR-502-3p	HITS-CLIP	23824327
MIRT614115	hsa-miR-764	HITS-CLIP	23824327
MIRT610899	hsa-miR-8064	HITS-CLIP	23824327
MIRT610898	hsa-miR-5589-3p	HITS-CLIP	23824327
MIRT614114	hsa-miR-3665	HITS-CLIP	23824327
MIRT610902	hsa-miR-8485	HITS-CLIP	23824327
MIRT610901	hsa-miR-501-3p	HITS-CLIP	23824327
MIRT610900	hsa-miR-502-3p	HITS-CLIP	23824327
MIRT610899	hsa-miR-8064	HITS-CLIP	23824327
MIRT610898	hsa-miR-5589-3p	HITS-CLIP	23824327
MIRT610902	hsa-miR-8485	HITS-CLIP	23824327
MIRT610901	hsa-miR-501-3p	HITS-CLIP	23824327
MIRT610900	hsa-miR-502-3p	HITS-CLIP	23824327
MIRT614115	hsa-miR-764	HITS-CLIP	23824327
MIRT610899	hsa-miR-8064	HITS-CLIP	23824327
MIRT610898	hsa-miR-5589-3p	HITS-CLIP	23824327
MIRT614114	hsa-miR-3665	HITS-CLIP	23824327
MIRT610902	hsa-miR-8485	HITS-CLIP	23824327
MIRT610901	hsa-miR-501-3p	HITS-CLIP	23824327
MIRT610900	hsa-miR-502-3p	HITS-CLIP	23824327
MIRT610899	hsa-miR-8064	HITS-CLIP	23824327
MIRT610898	hsa-miR-5589-3p	HITS-CLIP	23824327

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001867	Process	Complement activation, lectin pathway	IBA
GO:0001867	Process	Complement activation, lectin pathway	IDA	18204047, 22691502, 23386610
GO:0001867	Process	Complement activation, lectin pathway	IDA	10679061, 14707097, 15804047
GO:0001867	Process	Complement activation, lectin pathway	IEA
GO:0001905	Process	Activation of membrane attack complex	IDA	18204047
GO:0002376	Process	Immune system process	IEA
GO:0002752	Process	Cell surface pattern recognition receptor signaling pathway	NAS	17215869
GO:0003823	Function	Antigen binding	IBA
GO:0003823	Function	Antigen binding	IDA	8576206
GO:0005102	Function	Signaling receptor binding	IBA
GO:0005515	Function	Protein binding	IPI	19632990, 19939495, 21054788, 21490156, 23460739, 23785123, 27141819, 32094208
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005581	Component	Collagen trimer	IEA
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	NAS	10679061
GO:0006508	Process	Proteolysis	IDA	10679061
GO:0006956	Process	Complement activation	IDA	26841934, 30111885, 37852260
GO:0008228	Process	Opsonization	IDA	3897448, 8538770
GO:0008228	Process	Opsonization	IDA	8576206
GO:0009897	Component	External side of plasma membrane	NAS	10679061
GO:0030246	Function	Carbohydrate binding	IEA
GO:0031012	Component	Extracellular matrix	IBA
GO:0031638	Process	Zymogen activation	IDA	22691502, 23386610
GO:0031640	Process	Killing of cells of another organism	IDA	30552328
GO:0038187	Function	Pattern recognition receptor activity	IDA	8576206, 25344472
GO:0042802	Function	Identical protein binding	IPI	19109177
GO:0043394	Function	Proteoglycan binding	IDA	8576206
GO:0043654	Process	Recognition of apoptotic cell	IDA	15804047
GO:0045087	Process	Innate immune response	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0048306	Function	Calcium-dependent protein binding	IPI	12421953
GO:0050829	Process	Defense response to Gram-negative bacterium	IDA	8576206
GO:0050830	Process	Defense response to Gram-positive bacterium	IDA	14707097
GO:0051604	Process	Protein maturation	IDA	6906228, 18204047, 22691502
GO:0070062	Component	Extracellular exosome	HDA	19056867
GO:0070892	Function	Lipoteichoic acid immune receptor activity	IDA	14707097
GO:0072562	Component	Blood microparticle	HDA	22516433
GO:0097367	Function	Carbohydrate derivative binding	IBA
GO:0097367	Function	Carbohydrate derivative binding	IDA	8576206
GO:0106139	Component	Symbiont cell surface	IDA	25344472
GO:1903028	Process	Positive regulation of opsonization	IDA	10679061
GO:1905370	Component	Serine-type endopeptidase complex	IDA	10679061
GO:2001065	Function	Mannan binding	IDA	8576206

Other IDs

• MIM: 601624
• HGNC: 3624
• e!Ensembl: ENSG00000160339

Protein

• UniProt ID: Q15485
• Protein name: Ficolin-2 (37 kDa elastin-binding protein) (Collagen/fibrinogen domain-containing protein 2) (EBP-37) (Ficolin-B) (Ficolin-beta) (Hucolin) (L-ficolin) (Serum lectin p35)
• Protein function: May function in innate immunity through activation of the lectin complement pathway. Calcium-dependent and GlcNAc-binding lectin. Enhances phagocytosis of S.typhimurium by neutrophils, suggesting an opsonic effect via the collagen region. {ECO:0
• PDB: 2J0G, 2J0H, 2J0Y, 2J1G, 2J2P, 2J3F, 2J3G, 2J3O, 2J3U, 2J61, 4NYT, 4R9J, 4R9T
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01391	Collagen	39 → 98	Collagen triple helix repeat (20 copies)	Repeat
  PF00147	Fibrinogen_C	101 → 313	Fibrinogen beta and gamma chains, C-terminal globular domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed by the liver and secreted in plasma.
• Sequence:

  MELDRAVGVLGAATLLLSFLGMAWALQAADTCPEVKMVGLEGSDKLTILRGCPGLPGAPG
  PKGEAGTNGKRGERGPPGPPGKAGPPGPNGAPGEPQPCLTGPRTCKDLLDRGHFLSGWHT
  IYLPDCRPLTVLCDMDTDGGGWTVFQRRVDGSVDFYRDWATYKQGFGSRLGEFWLGNDNI
  HALTAQGTSELRVDLVDFEDNYQFAKYRSFKVADEAEKYNLVLGAFVEGSAGDSLTFHNN
  QSFSTKDQDNDLNTGNCAVMFQGAWWYKNCHVSNLNGRYLRGTHGSFANGINWKSGKGYN
  YSYKVSEMKVRPA

• Sequence length: 313

Pathways

Reactome:

Lectin pathway of complement activation
Initial triggering of complement
Ficolins bind to repetitive carbohydrate structures on the target cell surface

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ALZHEIMER DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, HEPATOCELLULAR	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FCN2-related disorder	Benign; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MESOTHELIOMA, MALIGNANT	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OLIGODENDROGLIOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
THYROTOXIC PERIODIC PARALYSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acquired Hypogammaglobulinemia	Common Variable Immunodeficiency	BEFREE	25251245		★☆☆☆☆ Found in Text Mining only
Age related macular degeneration	Age-related macular degeneration	BEFREE	26207622		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease, Early Onset	Alzheimer disease	BEFREE	15917097		★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	28912154		★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	21825040		★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	11228158		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	32641418	Associate	★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	25251245		★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet Syndrome	BEFREE	16839748, 18205865		★☆☆☆☆ Found in Text Mining only
Bronchiectasis	Bronchiectasis	BEFREE	25251245		★☆☆☆☆ Found in Text Mining only
Bronchiectasis	Bronchiectasis	Pubtator	25251245	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	22140517	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	26220728	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	22696682		★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	39390580	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	20603238, 23744477		★☆☆☆☆ Found in Text Mining only
Carditis	Carditis	BEFREE	28576308		★☆☆☆☆ Found in Text Mining only
CATARACT, ANTERIOR POLAR	Cataract	BEFREE	28032346		★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	32641418	Associate	★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	17493033, 30158515		★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	28109038		★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	BEFREE	21544067		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	UNIPROT_DG			★☆☆☆☆ Found in Text Mining only
Common Variable Immunodeficiency	Common Variable Immunodeficiency	BEFREE	25251245		★☆☆☆☆ Found in Text Mining only
Common Variable Immunodeficiency	Common variable immunodeficiency	Pubtator	25251245	Associate	★☆☆☆☆ Found in Text Mining only
Complete atrioventricular block	Complete Atrioventricular Block	BEFREE	30883302		★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	27312152		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	11118734, 9502407		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	10593565, 12496451		★☆☆☆☆ Found in Text Mining only
Familial Alzheimer Disease (FAD)	Alzheimer disease	BEFREE	28912154		★☆☆☆☆ Found in Text Mining only
Fleck corneal dystrophy	Fleck Corneal Dystrophy	BEFREE	18075258		★☆☆☆☆ Found in Text Mining only
Ganglioglioma	Ganglioglioma	BEFREE	15175076		★☆☆☆☆ Found in Text Mining only
Giant Cell Arteritis	Giant Cell Arteritis	BEFREE	29731755		★☆☆☆☆ Found in Text Mining only
Gingivitis	Gingivitis	BEFREE	18588867		★☆☆☆☆ Found in Text Mining only
Hepatic Veno Occlusive Disease	Hepatic veno occlusive disease	Pubtator	26172478	Associate	★☆☆☆☆ Found in Text Mining only
Hepatic Veno-Occlusive Disease	Hepatic veno-occlusive disease-immunodeficiency syndrome	BEFREE	27827824		★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	22140517, 26220728	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis B Chronic	Hepatitis b	Pubtator	26220728	Stimulate	★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	BEFREE	31715265		★☆☆☆☆ Found in Text Mining only
Immune thrombocytopenic purpura	Immune Thrombocytopenic Purpura	BEFREE	24994465		★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	27576476, 8656012		★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	21544067		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	28380665		★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	BEFREE	26469698		★☆☆☆☆ Found in Text Mining only
Juvenile arthritis	Arthritis	BEFREE	28405017		★☆☆☆☆ Found in Text Mining only
Kidney Failure Chronic	Kidney failure	Pubtator	30967869	Associate	★☆☆☆☆ Found in Text Mining only
Leprosy	Leprosy	BEFREE	23423485		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	27177473, 30747617, 30798068		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	CTD_human_DG	28284560		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	28109038		★☆☆☆☆ Found in Text Mining only
Liver Diseases	Liver disease	Pubtator	26220728	Associate	★☆☆☆☆ Found in Text Mining only
Liver Failure Acute	Liver failure	Pubtator	22140517	Associate	★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	30747617		★☆☆☆☆ Found in Text Mining only
Lung Diseases Interstitial	Lung disease	Pubtator	30885245	Associate	★☆☆☆☆ Found in Text Mining only
Lung Diseases, Interstitial	Lung Diseases	BEFREE	30885245		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	39390580	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus	Lupus Erythematosus	BEFREE	29045037		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Discoid	Lupus Erythematosus	BEFREE	29045037		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	10525320, 11014347, 12472178, 26464189, 29045037, 31184250		★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus Nephritis	BEFREE	27981461, 29045037, 31184250		★☆☆☆☆ Found in Text Mining only
Lupus Vulgaris	Lupus Vulgaris	BEFREE	29045037		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	32047495	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma, Large-Cell, Follicular	Lymphoma	BEFREE	12153001		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	12153001		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin, Familial	Lymphoma	BEFREE	12153001		★☆☆☆☆ Found in Text Mining only
Malignant mesothelioma	Malignant Mesothelioma	CTD_human_DG	23056237		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	22696682		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	20603238, 23744477		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	21825040, 31472403		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	20181942, 20603238, 23744477		★☆☆☆☆ Found in Text Mining only
Mannose-Binding Protein Deficiency	Mannose-Binding Protein Deficiency	BEFREE	18950864, 21974696		★☆☆☆☆ Found in Text Mining only
MASP2 Deficiency	MASP2 Deficiency	BEFREE	28109038		★☆☆☆☆ Found in Text Mining only
Medullary carcinoma of thyroid	Megalencephaly, Polymicrogyria, Polydactyly, Hydrocephalus Syndrome	BEFREE	17145757		★☆☆☆☆ Found in Text Mining only
Mental Retardation	Mental retardation	BEFREE	26469698		★☆☆☆☆ Found in Text Mining only
Motor Neuron Disease	Motor Neuron Disease	BEFREE	15009685		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	32047495	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	37903821	Associate	★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	22848725, 28216633		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	32736138	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	11358987, 12460909, 16763609, 16823838, 20603238, 28640256, 28844702		★☆☆☆☆ Found in Text Mining only
Nephritis	Nephritis	BEFREE	26464189, 29045037		★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	21338355		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	15485494		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	15307952, 17979810, 21844361, 24725413		★☆☆☆☆ Found in Text Mining only
Niemann-Pick Disease, Type C	Niemann-Pick Disease	BEFREE	16525053		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	20181942		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	20603238, 23744477		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	23744477	Inhibit	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	21825040, 31472403		★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	21825040		★☆☆☆☆ Found in Text Mining only
Paratuberculosis	Paratuberculosis	BEFREE	11118734		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	39739972	Associate	★☆☆☆☆ Found in Text Mining only
Pemphigus	Pemphigus	BEFREE	21327568		★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	18588867		★☆☆☆☆ Found in Text Mining only
Pre B-cell acute lymphoblastic leukemia	B-cell Lymphoma	BEFREE	24453114		★☆☆☆☆ Found in Text Mining only
Precursor B-cell lymphoblastic leukemia	Lymphoblastic Leukemia	BEFREE	24453114		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	15123618		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	29802736		★☆☆☆☆ Found in Text Mining only
Respiration Disorders	Respiration Disorders	BEFREE	19767106		★☆☆☆☆ Found in Text Mining only
Respiratory Tract Diseases	Respiratory Tract Diseases	BEFREE	19767106		★☆☆☆☆ Found in Text Mining only
Respiratory Tract Infections	Respiratory system infectious disease	Pubtator	17680820	Associate	★☆☆☆☆ Found in Text Mining only
Retinopathy of Prematurity	Retinopathy	BEFREE	31317786, 31788758		★☆☆☆☆ Found in Text Mining only
Rheumatic Fever	Rheumatic fever	Pubtator	19664148	Associate	★☆☆☆☆ Found in Text Mining only
Rheumatic Heart Disease	Rheumatic Heart Disease	BEFREE	19664148, 28576308		★☆☆☆☆ Found in Text Mining only
Rheumatic Heart Disease	Rheumatic heart disease	Pubtator	19664148	Associate	★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	25697137, 26464189		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	21772061		★☆☆☆☆ Found in Text Mining only
Scleroderma Systemic	Systemic sclerosis	Pubtator	30885245	Associate	★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	26850322		★☆☆☆☆ Found in Text Mining only
Spinal Muscular Atrophy	Spinal Muscular Atrophy	BEFREE	25878277		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	20957082	Associate	★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	29535807, 30885245		★☆☆☆☆ Found in Text Mining only
Tonsillitis	Tonsillitis	Pubtator	36833169	Associate	★☆☆☆☆ Found in Text Mining only
Tuberous Sclerosis	Tuberous Sclerosis	BEFREE	22612807		★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	30885245		★☆☆☆☆ Found in Text Mining only
X-Linked Lissencephaly	Lissencephaly, X-Linked	BEFREE	10826984		★☆☆☆☆ Found in Text Mining only