Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	221955
Gene name	Diacylglycerol lipase beta
Gene symbol	DAGLB
Synonyms (NCBI Gene)	DAGLBETAKCCR13L
Chromosome	7
Chromosome location	7p22.1

Show/Hide all (36)

miRTarBase ID	miRNA	Experiments	Reference
MIRT016573	hsa-miR-193b-3p	Proteomics	21512034
MIRT045074	hsa-miR-186-5p	CLASH	23622248
MIRT922883	hsa-miR-1324	CLIP-seq
MIRT922884	hsa-miR-1910	CLIP-seq
MIRT922885	hsa-miR-4713-3p	CLIP-seq
MIRT922886	hsa-miR-665	CLIP-seq
MIRT922887	hsa-miR-671-5p	CLIP-seq
MIRT922888	hsa-miR-140-3p	CLIP-seq
MIRT922889	hsa-miR-451b	CLIP-seq
MIRT922886	hsa-miR-665	CLIP-seq
MIRT2512851	hsa-miR-1193	CLIP-seq
MIRT2512852	hsa-miR-1267	CLIP-seq
MIRT2512853	hsa-miR-1292	CLIP-seq
MIRT922888	hsa-miR-140-3p	CLIP-seq
MIRT2512854	hsa-miR-197	CLIP-seq
MIRT2512855	hsa-miR-2052	CLIP-seq
MIRT2512856	hsa-miR-223	CLIP-seq
MIRT2512857	hsa-miR-224	CLIP-seq
MIRT2512858	hsa-miR-3134	CLIP-seq
MIRT2512859	hsa-miR-4328	CLIP-seq
MIRT2512860	hsa-miR-4471	CLIP-seq
MIRT2512861	hsa-miR-4477b	CLIP-seq
MIRT2512862	hsa-miR-4534	CLIP-seq
MIRT2512863	hsa-miR-4652-3p	CLIP-seq
MIRT2512864	hsa-miR-4768-3p	CLIP-seq
MIRT2512865	hsa-miR-4778-5p	CLIP-seq
MIRT2512866	hsa-miR-4786-5p	CLIP-seq
MIRT2512867	hsa-miR-591	CLIP-seq
MIRT2512868	hsa-miR-639	CLIP-seq
MIRT922886	hsa-miR-665	CLIP-seq
MIRT922887	hsa-miR-671-5p	CLIP-seq
MIRT2512869	hsa-miR-769-5p	CLIP-seq
MIRT922888	hsa-miR-140-3p	CLIP-seq
MIRT2512854	hsa-miR-197	CLIP-seq
MIRT2512864	hsa-miR-4768-3p	CLIP-seq
MIRT922886	hsa-miR-665	CLIP-seq

Show/Hide all (36)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001516	Process	Prostaglandin biosynthetic process	IEA
GO:0001516	Process	Prostaglandin biosynthetic process	ISS
GO:0004806	Function	Triacylglycerol lipase activity	IBA
GO:0004806	Function	Triacylglycerol lipase activity	IEA
GO:0004806	Function	Triacylglycerol lipase activity	ISS	31991095
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005654	Component	Nucleoplasm	IDA
GO:0005765	Component	Lysosomal membrane	HDA	17897319
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	14610053
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006640	Process	Monoacylglycerol biosynthetic process	IEA
GO:0006690	Process	Icosanoid metabolic process	IEA
GO:0007405	Process	Neuroblast proliferation	IEA
GO:0010898	Process	Positive regulation of triglyceride catabolic process	IEA
GO:0010898	Process	Positive regulation of triglyceride catabolic process	ISS	31991095
GO:0016020	Component	Membrane	IEA
GO:0016042	Process	Lipid catabolic process	IEA
GO:0016298	Function	Lipase activity	IDA	14610053
GO:0016298	Function	Lipase activity	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0019369	Process	Arachidonate metabolic process	IBA
GO:0019369	Process	Arachidonate metabolic process	IDA	14610053
GO:0019369	Process	Arachidonate metabolic process	IEA
GO:0019369	Process	Arachidonate metabolic process	TAS
GO:0022008	Process	Neurogenesis	IBA
GO:0022008	Process	Neurogenesis	IEA
GO:0046340	Process	Diacylglycerol catabolic process	IBA
GO:0046872	Function	Metal ion binding	IEA
GO:0047372	Function	Monoacylglycerol lipase activity	IEA
GO:0047372	Function	Monoacylglycerol lipase activity	TAS
GO:0050727	Process	Regulation of inflammatory response	IEA
GO:0050727	Process	Regulation of inflammatory response	ISS
GO:1901696	Process	Cannabinoid biosynthetic process	IEA

MIM	HGNC	e!Ensembl
614016	28923	ENSG00000164535

Q8NCG7

Protein name

Diacylglycerol lipase-beta (DAGL-beta) (DGL-beta) (EC 3.1.1.116) (KCCR13L) (PUFA-specific triacylglycerol lipase) (EC 3.1.1.3) (Sn1-specific diacylglycerol lipase beta)

Protein function

Lipase that catalyzes the hydrolysis of arachidonic acid (AA)-esterified diacylglycerols (DAGs) to produce the principal endocannabinoid, 2-arachidonoylglycerol (2-AG) which can be further cleaved by downstream enzymes to release arachidonic aci

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01764	Lipase_3	370 → 505	Lipase (class 3)	Family

Sequence

MPGMVLFGRRWAIASDDLVFPGFFELVVRVLWWIGILTLYLMHRGKLDCAGGALLSSYLI
VLMILLAVVICTVSAIMCVSMRGTICNPGPRKSMSKLLYIRLALFFPEMVWASLGAAWVA
DGVQCDRTVVNGIIATVVVSWIIIAATVVSIIIVFDPLGGKMAPYSSAGPSHLDSHDSSQ
LLNGLKTAATSVWETRIKLLCCCIGKDDHTRVAFSSTAELFSTYFSDTDLVPSDIAAGLA
LLHQQQDNIRNNQEPAQVVCHAPGSSQEADLDAELENCHHYMQFAAAAYGWPLYIYRNPL
TGLCRIGGDCCRSRTTDYDLVGGDQLNCHFGSILHTTGLQYRDFIHVSFHDKVYELPFLV
ALDHRKESVVVAVRGTMSLQDVLTDLSAESEVLDVECEVQDRLAHKGISQAARYVYQRLI
NDGILSQAFSIAPEYRLVIVGHSLGGGAAALLATMLRAAYPQVRCYAFSPPRGLWSKALQ
EYSQSFIVSLVLGKDVIPRLSVTNLEDLKRRILRVVAHCNKPKYKILLHGLWYELFGGNP
NNLPTELDGGDQEVLTQPLLGEQSLLTRWSPAYSFSSDSPLDSSPKYPPLYPPGRIIHLQ
EEGASGRFGCCSAAHYSAKWSHEAEFSKILIGPKMLTDHMPDILMRALDSVVSDRAACVS
CPAQGVSSVDVA

Sequence length

672

Interactions

View interactions

	KEGG		Reactome
	Retrograde endocannabinoid signaling Aldosterone synthesis and secretion		Arachidonate production from DAG

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (9)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ATOPIC ECZEMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHOLELITHIASIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GALLSTONES	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IRRITABLE BOWEL SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (5)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Breast Neoplasms	Breast neoplasm	Pubtator	35589867	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	GWASCAT_DG	29212778		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neuroblastoma	Neuroblastoma	Pubtator	21493725	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal carnitine transport defect	Renal Carnitine Transport Defect	BEFREE	27394933		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	35924232	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

DAGLB (diacylglycerol lipase beta)