Gene Gene information from NCBI Gene database.
Entrez ID 221927
Gene name BRCA1 associated ATM activator 1
Gene symbol BRAT1
Synonyms (NCBI Gene)
BAAT1C7orf27NEDCASRMFSL
Chromosome 7
Chromosome location 7p22.3
Summary The protein encoded by this ubiquitously expressed gene interacts with the tumor suppressing BRCA1 (breast cancer 1) protein and and the ATM (ataxia telangiectasia mutated) protein. ATM is thought to be a master controller of cell cycle checkpoint signall
SNPs SNP information provided by dbSNP.
31
SNP ID Visualize variation Clinical significance Consequence
rs61729932 G>A Conflicting-interpretations-of-pathogenicity Non coding transcript variant, 3 prime UTR variant, missense variant, coding sequence variant
rs61753094 G>A Uncertain-significance, conflicting-interpretations-of-pathogenicity Non coding transcript variant, missense variant, coding sequence variant
rs140833277 G>A Conflicting-interpretations-of-pathogenicity Coding sequence variant, missense variant, genic upstream transcript variant, non coding transcript variant, 5 prime UTR variant
rs145833100 C>T Conflicting-interpretations-of-pathogenicity 3 prime UTR variant, non coding transcript variant, coding sequence variant, missense variant
rs147005619 T>A Likely-pathogenic Intron variant, genic upstream transcript variant, splice acceptor variant
miRNA miRNA information provided by mirtarbase database.
65
miRTarBase ID miRNA Experiments Reference
MIRT016937 hsa-miR-335-5p Microarray 18185580
MIRT051289 hsa-miR-16-5p CLASH 23622248
MIRT050026 hsa-miR-27a-3p CLASH 23622248
MIRT046452 hsa-miR-15b-5p CLASH 23622248
MIRT046230 hsa-miR-27b-3p CLASH 23622248
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
26
GO ID Ontology Definition Evidence Reference
GO:0001934 Process Positive regulation of protein phosphorylation IMP 22977523
GO:0005515 Function Protein binding IPI 16452482, 22977523, 25631046, 25657994, 32296183, 32814053
GO:0005634 Component Nucleus IBA
GO:0005634 Component Nucleus IDA 39032489
GO:0005634 Component Nucleus IDA 16452482, 25631046
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
614506 21701 ENSG00000106009
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q6PJG6
Protein name Integrator complex assembly factor BRAT1 (BRCA1-associated ATM activator 1) (BRCA1-associated protein required for ATM activation protein 1)
Protein function Component of a multiprotein complex required for the assembly of the RNA endonuclease module of the integrator complex (PubMed:39032489, PubMed:39032490). Associates with INTS9 and INTS11 in the cytoplasm and blocks the active site of INTS11 to
PDB 4IFI , 8R22 , 8R23 , 8R2D , 8UIB
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF02985 HEAT 501 531 HEAT repeat Repeat
PF02985 HEAT 546 576 HEAT repeat Repeat
Tissue specificity TISSUE SPECIFICITY: Ubiquitously expressed. {ECO:0000269|PubMed:16452482}.
Sequence
MDPECAQLLPALCAVLVDPRQPVADDTCLEKLLDWFKTVTEGESSVVLLQEHPCLVELLS
HVLKVQDLSSGVLSFSLRLAGTFAAQENCFQYLQQGELLPGLFGEPGPLGRATWAVPTVR
SGWIQGLRSLAQHPSALRFLADHGAVDTIFSLQGDSSLFVASAASQLLVHVLALSMRGGA
EGQPCLPGGDWPACAQKIMDHVEESLCSAATPKVTQALNVLTTTFGRCQSPWTEALWVRL
SPRVACLLERDPIPAAHSFVDLLLCVARSPVFSSSDGSLWETVARALSCLGPTHMGPLAL
GILKLEHCPQALRTQAFQVLLQPLACVLKATVQAPGPPGLLDGTADDATTVDTLLASKSS
CAGLLCRTLAHLEELQPLPQRPSPWPQASLLGATVTVLRLCDGSAAPASSVGGHLCGTLA
GCVRVQRAALDFLGTLSQGTGPQELVTQALAVLLECLESPGSSPTVLKKAFQATLRWLLS
SPKTPGCSDLGPLIPQFLRELFPVLQKRLCHPCWEVRDSALEFLTQLSRHWGGQADFRCA
LLASEVPQLALQLLQDPESYVRASAVTAMGQLSSQGLHAPTSPEHAEARQSLFLELLHIL
SVDSEGFPRRAVMQVFTEWLRDGHADAAQDTEQFVATVLQAASRDLDWEVRAQGLELALV
FLGQTLGPPRTHCPYAVALPEVAPAQPLTEALRALCHVGLFDFAFCALFDCDRPVAQKSC
DLLLFLRDKIASYSSLREARGSPNTASAEATLPRWRAGEQAQPPGDQEPEAVLAMLRSLD
LEGLRSTLAESSDHVEKSPQSLLQDMLATGGFLQGDEADCY
Sequence length 821
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
25
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession Evidence Score
BRAT1-associated neurodegenerative disorder Likely pathogenic; Pathogenic rs763527391 RCV001265553
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
BRAT1-related disorder Likely pathogenic; Pathogenic rs727505362, rs776913277, rs776341501, rs149814450, rs763527391, rs730880324, rs1463777746 RCV004531196
RCV004739648
RCV004545850
RCV003397184
RCV004530515
View all (2 more)
★★★★★
ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
BRAT1-related neurodevelopmental disorder Likely pathogenic rs754828716 RCV003225688
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Neonatal-onset encephalopathy with rigidity and seizures Pathogenic; Likely pathogenic rs762469913, rs2128384059, rs1778893542, rs746081291, rs727505362, rs1335347265, rs2128390167, rs1188555703, rs1780257580, rs755075934, rs2128393384, rs2128395588, rs1562567814, rs1778838576, rs1554296088
View all (58 more)
RCV001333591
RCV001385214
RCV001388478
RCV001383083
RCV001386843
View all (68 more)
★★★★★
ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
Cervical cancer Likely benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney Uncertain significance ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
EBV-positive nodal T- and NK-cell lymphoma Uncertain significance ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Familial cancer of breast Conflicting classifications of pathogenicity ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Apnea Apnea Pubtator 33040300 Associate
★☆☆☆☆
Found in Text Mining only
Apraxias Apraxia Pubtator 28635423, 35360849 Associate
★☆☆☆☆
Found in Text Mining only
Ataxia Ataxia Pubtator 35360849 Associate
★☆☆☆☆
Found in Text Mining only
Atrophy Atrophy Pubtator 26947546 Associate
★☆☆☆☆
Found in Text Mining only
Bradycardia Bradycardia Pubtator 33040300 Associate
★☆☆☆☆
Found in Text Mining only
Brain Diseases Brain disease Pubtator 26947546, 29997391, 30786674, 33040300, 36599696 Associate
★☆☆☆☆
Found in Text Mining only
Byzanthine arch palate High palate HPO_DG
★☆☆☆☆
Found in Text Mining only
Central Nervous System Diseases Central nervous system disease Pubtator 30786674 Associate
★☆☆☆☆
Found in Text Mining only
Cerebellar Ataxia Cerebellar ataxia Pubtator 28635423 Associate
★☆☆☆☆
Found in Text Mining only
Cerebellar atrophy Cerebellar atrophy BEFREE 28635423
★☆☆☆☆
Found in Text Mining only