Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	221895
Gene name	JAZF zinc finger 1
Gene symbol	JAZF1
Synonyms (NCBI Gene)	TIP27ZNF802
Chromosome	7
Chromosome location	7p15.2-p15.1
Summary	This gene encodes a nuclear protein with three C2H2-type zinc fingers, and functions as a transcriptional repressor. Chromosomal aberrations involving this gene are associated with endometrial stromal tumors. Alternatively spliced variants which encode di

434

Show/Hide all (434)

miRTarBase ID	miRNA	Experiments	Reference
MIRT004973	hsa-miR-31-5p	Luciferase reporter assayqRT-PCR	19524507
MIRT027883	hsa-miR-96-5p	Sequencing	20371350
MIRT052411	hsa-let-7a-5p	CLASH	23622248
MIRT051478	hsa-let-7e-5p	CLASH	23622248
MIRT612856	hsa-miR-377-3p	HITS-CLIP	23824327
MIRT612855	hsa-miR-8485	HITS-CLIP	23824327
MIRT612854	hsa-miR-603	HITS-CLIP	23824327
MIRT612853	hsa-miR-216b-3p	HITS-CLIP	23824327
MIRT667803	hsa-miR-548ao-5p	HITS-CLIP	23824327
MIRT667802	hsa-miR-548ax	HITS-CLIP	23824327
MIRT667801	hsa-miR-5585-5p	HITS-CLIP	23824327
MIRT612852	hsa-miR-7703	HITS-CLIP	23824327
MIRT612851	hsa-miR-4325	HITS-CLIP	23824327
MIRT320551	hsa-miR-507	HITS-CLIP	23824327
MIRT320552	hsa-miR-557	HITS-CLIP	23824327
MIRT612856	hsa-miR-377-3p	HITS-CLIP	23824327
MIRT612855	hsa-miR-8485	HITS-CLIP	23824327
MIRT612854	hsa-miR-603	HITS-CLIP	23824327
MIRT612853	hsa-miR-216b-3p	HITS-CLIP	23824327
MIRT612852	hsa-miR-7703	HITS-CLIP	23824327
MIRT612851	hsa-miR-4325	HITS-CLIP	23824327
MIRT320551	hsa-miR-507	HITS-CLIP	23824327
MIRT320552	hsa-miR-557	HITS-CLIP	23824327
MIRT612856	hsa-miR-377-3p	HITS-CLIP	23824327
MIRT612855	hsa-miR-8485	HITS-CLIP	23824327
MIRT612854	hsa-miR-603	HITS-CLIP	23824327
MIRT612853	hsa-miR-216b-3p	HITS-CLIP	23824327
MIRT612852	hsa-miR-7703	HITS-CLIP	23824327
MIRT612851	hsa-miR-4325	HITS-CLIP	23824327
MIRT320551	hsa-miR-507	HITS-CLIP	23824327
MIRT320552	hsa-miR-557	HITS-CLIP	23824327
MIRT612856	hsa-miR-377-3p	HITS-CLIP	23824327
MIRT612855	hsa-miR-8485	HITS-CLIP	23824327
MIRT612854	hsa-miR-603	HITS-CLIP	23824327
MIRT612853	hsa-miR-216b-3p	HITS-CLIP	23824327
MIRT612852	hsa-miR-7703	HITS-CLIP	23824327
MIRT612851	hsa-miR-4325	HITS-CLIP	23824327
MIRT320551	hsa-miR-507	HITS-CLIP	23824327
MIRT320552	hsa-miR-557	HITS-CLIP	23824327
MIRT612856	hsa-miR-377-3p	HITS-CLIP	23824327
MIRT630438	hsa-miR-3129-3p	HITS-CLIP	23824327
MIRT630437	hsa-miR-5583-5p	HITS-CLIP	23824327
MIRT612855	hsa-miR-8485	HITS-CLIP	23824327
MIRT612854	hsa-miR-603	HITS-CLIP	23824327
MIRT612853	hsa-miR-216b-3p	HITS-CLIP	23824327
MIRT612852	hsa-miR-7703	HITS-CLIP	23824327
MIRT612851	hsa-miR-4325	HITS-CLIP	23824327
MIRT320551	hsa-miR-507	HITS-CLIP	23824327
MIRT320552	hsa-miR-557	HITS-CLIP	23824327
MIRT612856	hsa-miR-377-3p	HITS-CLIP	23824327
MIRT612855	hsa-miR-8485	HITS-CLIP	23824327
MIRT612854	hsa-miR-603	HITS-CLIP	23824327
MIRT612853	hsa-miR-216b-3p	HITS-CLIP	23824327
MIRT612852	hsa-miR-7703	HITS-CLIP	23824327
MIRT612851	hsa-miR-4325	HITS-CLIP	23824327
MIRT320551	hsa-miR-507	HITS-CLIP	23824327
MIRT320552	hsa-miR-557	HITS-CLIP	23824327
MIRT612856	hsa-miR-377-3p	HITS-CLIP	23824327
MIRT612855	hsa-miR-8485	HITS-CLIP	23824327
MIRT612854	hsa-miR-603	HITS-CLIP	23824327
MIRT612853	hsa-miR-216b-3p	HITS-CLIP	23824327
MIRT612852	hsa-miR-7703	HITS-CLIP	23824327
MIRT612851	hsa-miR-4325	HITS-CLIP	23824327
MIRT320551	hsa-miR-507	HITS-CLIP	23824327
MIRT320552	hsa-miR-557	HITS-CLIP	23824327
MIRT612856	hsa-miR-377-3p	HITS-CLIP	23824327
MIRT630438	hsa-miR-3129-3p	HITS-CLIP	23824327
MIRT630437	hsa-miR-5583-5p	HITS-CLIP	23824327
MIRT612855	hsa-miR-8485	HITS-CLIP	23824327
MIRT612854	hsa-miR-603	HITS-CLIP	23824327
MIRT612853	hsa-miR-216b-3p	HITS-CLIP	23824327
MIRT612852	hsa-miR-7703	HITS-CLIP	23824327
MIRT612851	hsa-miR-4325	HITS-CLIP	23824327
MIRT320551	hsa-miR-507	HITS-CLIP	23824327
MIRT320552	hsa-miR-557	HITS-CLIP	23824327
MIRT612856	hsa-miR-377-3p	HITS-CLIP	23824327
MIRT612855	hsa-miR-8485	HITS-CLIP	23824327
MIRT612854	hsa-miR-603	HITS-CLIP	23824327
MIRT612853	hsa-miR-216b-3p	HITS-CLIP	23824327
MIRT612852	hsa-miR-7703	HITS-CLIP	23824327
MIRT612851	hsa-miR-4325	HITS-CLIP	23824327
MIRT320551	hsa-miR-507	HITS-CLIP	23824327
MIRT320552	hsa-miR-557	HITS-CLIP	23824327
MIRT612856	hsa-miR-377-3p	HITS-CLIP	23824327
MIRT612855	hsa-miR-8485	HITS-CLIP	23824327
MIRT612854	hsa-miR-603	HITS-CLIP	23824327
MIRT612853	hsa-miR-216b-3p	HITS-CLIP	23824327
MIRT612852	hsa-miR-7703	HITS-CLIP	23824327
MIRT612851	hsa-miR-4325	HITS-CLIP	23824327
MIRT320551	hsa-miR-507	HITS-CLIP	23824327
MIRT320552	hsa-miR-557	HITS-CLIP	23824327
MIRT612856	hsa-miR-377-3p	HITS-CLIP	23824327
MIRT612855	hsa-miR-8485	HITS-CLIP	23824327
MIRT612854	hsa-miR-603	HITS-CLIP	23824327
MIRT612853	hsa-miR-216b-3p	HITS-CLIP	23824327
MIRT612852	hsa-miR-7703	HITS-CLIP	23824327
MIRT612851	hsa-miR-4325	HITS-CLIP	23824327
MIRT320551	hsa-miR-507	HITS-CLIP	23824327
MIRT320552	hsa-miR-557	HITS-CLIP	23824327
MIRT612856	hsa-miR-377-3p	HITS-CLIP	23824327
MIRT612855	hsa-miR-8485	HITS-CLIP	23824327
MIRT612854	hsa-miR-603	HITS-CLIP	23824327
MIRT612853	hsa-miR-216b-3p	HITS-CLIP	23824327
MIRT612852	hsa-miR-7703	HITS-CLIP	23824327
MIRT612851	hsa-miR-4325	HITS-CLIP	23824327
MIRT320551	hsa-miR-507	HITS-CLIP	23824327
MIRT320552	hsa-miR-557	HITS-CLIP	23824327
MIRT612856	hsa-miR-377-3p	HITS-CLIP	23824327
MIRT612855	hsa-miR-8485	HITS-CLIP	23824327
MIRT612854	hsa-miR-603	HITS-CLIP	23824327
MIRT612853	hsa-miR-216b-3p	HITS-CLIP	23824327
MIRT612852	hsa-miR-7703	HITS-CLIP	23824327
MIRT612851	hsa-miR-4325	HITS-CLIP	23824327
MIRT320551	hsa-miR-507	HITS-CLIP	23824327
MIRT320552	hsa-miR-557	HITS-CLIP	23824327
MIRT612856	hsa-miR-377-3p	HITS-CLIP	23824327
MIRT612855	hsa-miR-8485	HITS-CLIP	23824327
MIRT612854	hsa-miR-603	HITS-CLIP	23824327
MIRT612853	hsa-miR-216b-3p	HITS-CLIP	23824327
MIRT612852	hsa-miR-7703	HITS-CLIP	23824327
MIRT612851	hsa-miR-4325	HITS-CLIP	23824327
MIRT320551	hsa-miR-507	HITS-CLIP	23824327
MIRT320552	hsa-miR-557	HITS-CLIP	23824327
MIRT556867	hsa-miR-19a-3p	PAR-CLIP	21572407
MIRT556866	hsa-miR-19b-3p	PAR-CLIP	21572407
MIRT320532	hsa-miR-8063	PAR-CLIP	21572407
MIRT556865	hsa-miR-4666a-5p	PAR-CLIP	21572407
MIRT320548	hsa-let-7c-3p	PAR-CLIP	21572407
MIRT440414	hsa-miR-379-3p	HITS-CLIP	24374217
MIRT440414	hsa-miR-379-3p	HITS-CLIP	24374217
MIRT612856	hsa-miR-377-3p	HITS-CLIP	23824327
MIRT612855	hsa-miR-8485	HITS-CLIP	23824327
MIRT612854	hsa-miR-603	HITS-CLIP	23824327
MIRT612853	hsa-miR-216b-3p	HITS-CLIP	23824327
MIRT667803	hsa-miR-548ao-5p	HITS-CLIP	23824327
MIRT667802	hsa-miR-548ax	HITS-CLIP	23824327
MIRT667801	hsa-miR-5585-5p	HITS-CLIP	23824327
MIRT612852	hsa-miR-7703	HITS-CLIP	23824327
MIRT612851	hsa-miR-4325	HITS-CLIP	23824327
MIRT320551	hsa-miR-507	HITS-CLIP	23824327
MIRT320552	hsa-miR-557	HITS-CLIP	23824327
MIRT612856	hsa-miR-377-3p	HITS-CLIP	23824327
MIRT612855	hsa-miR-8485	HITS-CLIP	23824327
MIRT612854	hsa-miR-603	HITS-CLIP	23824327
MIRT612853	hsa-miR-216b-3p	HITS-CLIP	23824327
MIRT612852	hsa-miR-7703	HITS-CLIP	23824327
MIRT612851	hsa-miR-4325	HITS-CLIP	23824327
MIRT320551	hsa-miR-507	HITS-CLIP	23824327
MIRT320552	hsa-miR-557	HITS-CLIP	23824327
MIRT612856	hsa-miR-377-3p	HITS-CLIP	23824327
MIRT612855	hsa-miR-8485	HITS-CLIP	23824327
MIRT612854	hsa-miR-603	HITS-CLIP	23824327
MIRT612853	hsa-miR-216b-3p	HITS-CLIP	23824327
MIRT612852	hsa-miR-7703	HITS-CLIP	23824327
MIRT612851	hsa-miR-4325	HITS-CLIP	23824327
MIRT320551	hsa-miR-507	HITS-CLIP	23824327
MIRT320552	hsa-miR-557	HITS-CLIP	23824327
MIRT612856	hsa-miR-377-3p	HITS-CLIP	23824327
MIRT612855	hsa-miR-8485	HITS-CLIP	23824327
MIRT612854	hsa-miR-603	HITS-CLIP	23824327
MIRT612853	hsa-miR-216b-3p	HITS-CLIP	23824327
MIRT612852	hsa-miR-7703	HITS-CLIP	23824327
MIRT612851	hsa-miR-4325	HITS-CLIP	23824327
MIRT320551	hsa-miR-507	HITS-CLIP	23824327
MIRT320552	hsa-miR-557	HITS-CLIP	23824327
MIRT612856	hsa-miR-377-3p	HITS-CLIP	23824327
MIRT630438	hsa-miR-3129-3p	HITS-CLIP	23824327
MIRT630437	hsa-miR-5583-5p	HITS-CLIP	23824327
MIRT612855	hsa-miR-8485	HITS-CLIP	23824327
MIRT612854	hsa-miR-603	HITS-CLIP	23824327
MIRT612853	hsa-miR-216b-3p	HITS-CLIP	23824327
MIRT612852	hsa-miR-7703	HITS-CLIP	23824327
MIRT612851	hsa-miR-4325	HITS-CLIP	23824327
MIRT320551	hsa-miR-507	HITS-CLIP	23824327
MIRT320552	hsa-miR-557	HITS-CLIP	23824327
MIRT612856	hsa-miR-377-3p	HITS-CLIP	23824327
MIRT612855	hsa-miR-8485	HITS-CLIP	23824327
MIRT612854	hsa-miR-603	HITS-CLIP	23824327
MIRT612853	hsa-miR-216b-3p	HITS-CLIP	23824327
MIRT612852	hsa-miR-7703	HITS-CLIP	23824327
MIRT612851	hsa-miR-4325	HITS-CLIP	23824327
MIRT320551	hsa-miR-507	HITS-CLIP	23824327
MIRT320552	hsa-miR-557	HITS-CLIP	23824327
MIRT612856	hsa-miR-377-3p	HITS-CLIP	23824327
MIRT612855	hsa-miR-8485	HITS-CLIP	23824327
MIRT612854	hsa-miR-603	HITS-CLIP	23824327
MIRT612853	hsa-miR-216b-3p	HITS-CLIP	23824327
MIRT612852	hsa-miR-7703	HITS-CLIP	23824327
MIRT612851	hsa-miR-4325	HITS-CLIP	23824327
MIRT320551	hsa-miR-507	HITS-CLIP	23824327
MIRT320552	hsa-miR-557	HITS-CLIP	23824327
MIRT612856	hsa-miR-377-3p	HITS-CLIP	23824327
MIRT630438	hsa-miR-3129-3p	HITS-CLIP	23824327
MIRT630437	hsa-miR-5583-5p	HITS-CLIP	23824327
MIRT612855	hsa-miR-8485	HITS-CLIP	23824327
MIRT612854	hsa-miR-603	HITS-CLIP	23824327
MIRT612853	hsa-miR-216b-3p	HITS-CLIP	23824327
MIRT612852	hsa-miR-7703	HITS-CLIP	23824327
MIRT612851	hsa-miR-4325	HITS-CLIP	23824327
MIRT320551	hsa-miR-507	HITS-CLIP	23824327
MIRT320552	hsa-miR-557	HITS-CLIP	23824327
MIRT612856	hsa-miR-377-3p	HITS-CLIP	23824327
MIRT612855	hsa-miR-8485	HITS-CLIP	23824327
MIRT612854	hsa-miR-603	HITS-CLIP	23824327
MIRT612853	hsa-miR-216b-3p	HITS-CLIP	23824327
MIRT612852	hsa-miR-7703	HITS-CLIP	23824327
MIRT612851	hsa-miR-4325	HITS-CLIP	23824327
MIRT320551	hsa-miR-507	HITS-CLIP	23824327
MIRT320552	hsa-miR-557	HITS-CLIP	23824327
MIRT612856	hsa-miR-377-3p	HITS-CLIP	23824327
MIRT612855	hsa-miR-8485	HITS-CLIP	23824327
MIRT612854	hsa-miR-603	HITS-CLIP	23824327
MIRT612853	hsa-miR-216b-3p	HITS-CLIP	23824327
MIRT612852	hsa-miR-7703	HITS-CLIP	23824327
MIRT612851	hsa-miR-4325	HITS-CLIP	23824327
MIRT320551	hsa-miR-507	HITS-CLIP	23824327
MIRT320552	hsa-miR-557	HITS-CLIP	23824327
MIRT612856	hsa-miR-377-3p	HITS-CLIP	23824327
MIRT612855	hsa-miR-8485	HITS-CLIP	23824327
MIRT612854	hsa-miR-603	HITS-CLIP	23824327
MIRT612853	hsa-miR-216b-3p	HITS-CLIP	23824327
MIRT612852	hsa-miR-7703	HITS-CLIP	23824327
MIRT612851	hsa-miR-4325	HITS-CLIP	23824327
MIRT320551	hsa-miR-507	HITS-CLIP	23824327
MIRT320552	hsa-miR-557	HITS-CLIP	23824327
MIRT612856	hsa-miR-377-3p	HITS-CLIP	23824327
MIRT612855	hsa-miR-8485	HITS-CLIP	23824327
MIRT612854	hsa-miR-603	HITS-CLIP	23824327
MIRT612853	hsa-miR-216b-3p	HITS-CLIP	23824327
MIRT612852	hsa-miR-7703	HITS-CLIP	23824327
MIRT612851	hsa-miR-4325	HITS-CLIP	23824327
MIRT320551	hsa-miR-507	HITS-CLIP	23824327
MIRT320552	hsa-miR-557	HITS-CLIP	23824327
MIRT612856	hsa-miR-377-3p	HITS-CLIP	23824327
MIRT612855	hsa-miR-8485	HITS-CLIP	23824327
MIRT612854	hsa-miR-603	HITS-CLIP	23824327
MIRT612853	hsa-miR-216b-3p	HITS-CLIP	23824327
MIRT612852	hsa-miR-7703	HITS-CLIP	23824327
MIRT612851	hsa-miR-4325	HITS-CLIP	23824327
MIRT320551	hsa-miR-507	HITS-CLIP	23824327
MIRT320552	hsa-miR-557	HITS-CLIP	23824327
MIRT612856	hsa-miR-377-3p	HITS-CLIP	23824327
MIRT612855	hsa-miR-8485	HITS-CLIP	23824327
MIRT612854	hsa-miR-603	HITS-CLIP	23824327
MIRT612853	hsa-miR-216b-3p	HITS-CLIP	23824327
MIRT612852	hsa-miR-7703	HITS-CLIP	23824327
MIRT612851	hsa-miR-4325	HITS-CLIP	23824327
MIRT320551	hsa-miR-507	HITS-CLIP	23824327
MIRT320552	hsa-miR-557	HITS-CLIP	23824327
MIRT556867	hsa-miR-19a-3p	PAR-CLIP	21572407
MIRT556866	hsa-miR-19b-3p	PAR-CLIP	21572407
MIRT320532	hsa-miR-8063	PAR-CLIP	21572407
MIRT556865	hsa-miR-4666a-5p	PAR-CLIP	21572407
MIRT320548	hsa-let-7c-3p	PAR-CLIP	21572407
MIRT1076543	hsa-miR-1228	CLIP-seq
MIRT1076544	hsa-miR-129-5p	CLIP-seq
MIRT1076545	hsa-miR-133a	CLIP-seq
MIRT1076546	hsa-miR-133b	CLIP-seq
MIRT1076547	hsa-miR-141	CLIP-seq
MIRT1076548	hsa-miR-196a	CLIP-seq
MIRT1076549	hsa-miR-196b	CLIP-seq
MIRT1076550	hsa-miR-200a	CLIP-seq
MIRT1076551	hsa-miR-3115	CLIP-seq
MIRT1076552	hsa-miR-3171	CLIP-seq
MIRT1076553	hsa-miR-3176	CLIP-seq
MIRT1076554	hsa-miR-3662	CLIP-seq
MIRT1076555	hsa-miR-3922-3p	CLIP-seq
MIRT1076556	hsa-miR-3927	CLIP-seq
MIRT1076557	hsa-miR-4282	CLIP-seq
MIRT1076558	hsa-miR-4422	CLIP-seq
MIRT1076559	hsa-miR-4427	CLIP-seq
MIRT1076560	hsa-miR-4432	CLIP-seq
MIRT1076561	hsa-miR-4501	CLIP-seq
MIRT1076562	hsa-miR-4698	CLIP-seq
MIRT1076563	hsa-miR-4729	CLIP-seq
MIRT1076564	hsa-miR-499-3p	CLIP-seq
MIRT1076565	hsa-miR-499-5p	CLIP-seq
MIRT1076566	hsa-miR-499a-3p	CLIP-seq
MIRT1076567	hsa-miR-586	CLIP-seq
MIRT1550359	hsa-miR-1284	CLIP-seq
MIRT1550360	hsa-miR-144	CLIP-seq
MIRT1550361	hsa-miR-4672	CLIP-seq
MIRT1076563	hsa-miR-4729	CLIP-seq
MIRT1550362	hsa-miR-4789-5p	CLIP-seq
MIRT2019041	hsa-miR-138	CLIP-seq
MIRT2019042	hsa-miR-29a	CLIP-seq
MIRT2019043	hsa-miR-29b	CLIP-seq
MIRT2019044	hsa-miR-29c	CLIP-seq
MIRT2019045	hsa-miR-3973	CLIP-seq
MIRT2250843	hsa-miR-101	CLIP-seq
MIRT2250844	hsa-miR-1185	CLIP-seq
MIRT2250845	hsa-miR-1271	CLIP-seq
MIRT2250846	hsa-miR-1912	CLIP-seq
MIRT2250847	hsa-miR-214	CLIP-seq
MIRT2250848	hsa-miR-27a	CLIP-seq
MIRT2250849	hsa-miR-27b	CLIP-seq
MIRT2250850	hsa-miR-3130-5p	CLIP-seq
MIRT2250851	hsa-miR-3133	CLIP-seq
MIRT2250852	hsa-miR-3167	CLIP-seq
MIRT2250853	hsa-miR-338-3p	CLIP-seq
MIRT2250854	hsa-miR-338-5p	CLIP-seq
MIRT2250855	hsa-miR-3605-5p	CLIP-seq
MIRT2250856	hsa-miR-3619-5p	CLIP-seq
MIRT2250857	hsa-miR-3679-5p	CLIP-seq
MIRT2250858	hsa-miR-3910	CLIP-seq
MIRT2250859	hsa-miR-3922-5p	CLIP-seq
MIRT2250860	hsa-miR-4269	CLIP-seq
MIRT2250861	hsa-miR-4328	CLIP-seq
MIRT1076558	hsa-miR-4422	CLIP-seq
MIRT2250862	hsa-miR-4436a	CLIP-seq
MIRT2250863	hsa-miR-4482	CLIP-seq
MIRT2250864	hsa-miR-4530	CLIP-seq
MIRT2250865	hsa-miR-4690-5p	CLIP-seq
MIRT2250866	hsa-miR-4705	CLIP-seq
MIRT1076563	hsa-miR-4729	CLIP-seq
MIRT2250867	hsa-miR-5096	CLIP-seq
MIRT2250868	hsa-miR-513a-5p	CLIP-seq
MIRT2250869	hsa-miR-578	CLIP-seq
MIRT2250870	hsa-miR-634	CLIP-seq
MIRT2250871	hsa-miR-761	CLIP-seq
MIRT2250872	hsa-miR-876-5p	CLIP-seq
MIRT2250873	hsa-miR-96	CLIP-seq
MIRT2430186	hsa-miR-1272	CLIP-seq
MIRT2430187	hsa-miR-1283	CLIP-seq
MIRT2430188	hsa-miR-1322	CLIP-seq
MIRT2430189	hsa-miR-19a	CLIP-seq
MIRT2430190	hsa-miR-19b	CLIP-seq
MIRT2430191	hsa-miR-3121-3p	CLIP-seq
MIRT2430192	hsa-miR-3127-5p	CLIP-seq
MIRT2430193	hsa-miR-3148	CLIP-seq
MIRT2430194	hsa-miR-3673	CLIP-seq
MIRT2430195	hsa-miR-3682-3p	CLIP-seq
MIRT2430196	hsa-miR-3942-3p	CLIP-seq
MIRT2019045	hsa-miR-3973	CLIP-seq
MIRT2430197	hsa-miR-4270	CLIP-seq
MIRT2430198	hsa-miR-4441	CLIP-seq
MIRT2430199	hsa-miR-4506	CLIP-seq
MIRT2430200	hsa-miR-4666-5p	CLIP-seq
MIRT2430201	hsa-miR-4668-5p	CLIP-seq
MIRT2430202	hsa-miR-4694-3p	CLIP-seq
MIRT2430203	hsa-miR-4764-3p	CLIP-seq
MIRT1076564	hsa-miR-499-3p	CLIP-seq
MIRT1076566	hsa-miR-499a-3p	CLIP-seq
MIRT2430204	hsa-miR-520d-5p	CLIP-seq
MIRT2430205	hsa-miR-522	CLIP-seq
MIRT2430206	hsa-miR-524-5p	CLIP-seq
MIRT2430207	hsa-miR-548l	CLIP-seq
MIRT2430208	hsa-miR-548n	CLIP-seq
MIRT2430209	hsa-miR-618	CLIP-seq
MIRT2250843	hsa-miR-101	CLIP-seq
MIRT1550359	hsa-miR-1284	CLIP-seq
MIRT1550360	hsa-miR-144	CLIP-seq
MIRT2438054	hsa-miR-181a	CLIP-seq
MIRT2438055	hsa-miR-181b	CLIP-seq
MIRT2438056	hsa-miR-181c	CLIP-seq
MIRT2438057	hsa-miR-181d	CLIP-seq
MIRT2250854	hsa-miR-338-5p	CLIP-seq
MIRT2438058	hsa-miR-4262	CLIP-seq
MIRT1550361	hsa-miR-4672	CLIP-seq
MIRT1550362	hsa-miR-4789-5p	CLIP-seq
MIRT2438059	hsa-miR-495	CLIP-seq
MIRT2250843	hsa-miR-101	CLIP-seq
MIRT2554377	hsa-miR-124	CLIP-seq
MIRT2554378	hsa-miR-1267	CLIP-seq
MIRT2430187	hsa-miR-1283	CLIP-seq
MIRT1550359	hsa-miR-1284	CLIP-seq
MIRT2554379	hsa-miR-136	CLIP-seq
MIRT1550360	hsa-miR-144	CLIP-seq
MIRT2438054	hsa-miR-181a	CLIP-seq
MIRT2438055	hsa-miR-181b	CLIP-seq
MIRT2438056	hsa-miR-181c	CLIP-seq
MIRT2438057	hsa-miR-181d	CLIP-seq
MIRT2554380	hsa-miR-2052	CLIP-seq
MIRT2554381	hsa-miR-219-1-3p	CLIP-seq
MIRT2554382	hsa-miR-23a	CLIP-seq
MIRT2554383	hsa-miR-23b	CLIP-seq
MIRT2554384	hsa-miR-23c	CLIP-seq
MIRT2554385	hsa-miR-3065-5p	CLIP-seq
MIRT2430191	hsa-miR-3121-3p	CLIP-seq
MIRT2554386	hsa-miR-3143	CLIP-seq
MIRT2554387	hsa-miR-3161	CLIP-seq
MIRT2554388	hsa-miR-3166	CLIP-seq
MIRT2554389	hsa-miR-3183	CLIP-seq
MIRT2554390	hsa-miR-323-3p	CLIP-seq
MIRT2250854	hsa-miR-338-5p	CLIP-seq
MIRT2554391	hsa-miR-3622b-5p	CLIP-seq
MIRT2430194	hsa-miR-3673	CLIP-seq
MIRT2554392	hsa-miR-3714	CLIP-seq
MIRT2554393	hsa-miR-380	CLIP-seq
MIRT2250858	hsa-miR-3910	CLIP-seq
MIRT2554394	hsa-miR-3924	CLIP-seq
MIRT2554395	hsa-miR-421	CLIP-seq
MIRT2438058	hsa-miR-4262	CLIP-seq
MIRT2554396	hsa-miR-4272	CLIP-seq
MIRT1076558	hsa-miR-4422	CLIP-seq
MIRT2554397	hsa-miR-4495	CLIP-seq
MIRT1076561	hsa-miR-4501	CLIP-seq
MIRT2554398	hsa-miR-452	CLIP-seq
MIRT2554399	hsa-miR-4666-3p	CLIP-seq
MIRT1550361	hsa-miR-4672	CLIP-seq
MIRT2554400	hsa-miR-4676-3p	CLIP-seq
MIRT2554401	hsa-miR-4678	CLIP-seq
MIRT2554402	hsa-miR-4684-5p	CLIP-seq
MIRT2250866	hsa-miR-4705	CLIP-seq
MIRT2554403	hsa-miR-4723-3p	CLIP-seq
MIRT2430203	hsa-miR-4764-3p	CLIP-seq
MIRT2554404	hsa-miR-4771	CLIP-seq
MIRT1550362	hsa-miR-4789-5p	CLIP-seq
MIRT2554405	hsa-miR-4795-3p	CLIP-seq
MIRT2554406	hsa-miR-488	CLIP-seq
MIRT2554407	hsa-miR-493	CLIP-seq
MIRT2554408	hsa-miR-506	CLIP-seq
MIRT2554409	hsa-miR-570	CLIP-seq
MIRT2554410	hsa-miR-571	CLIP-seq
MIRT2554411	hsa-miR-580	CLIP-seq
MIRT2554412	hsa-miR-590-3p	CLIP-seq
MIRT2554413	hsa-miR-653	CLIP-seq
MIRT2554414	hsa-miR-659	CLIP-seq
MIRT2554415	hsa-miR-885-5p	CLIP-seq
MIRT2554416	hsa-miR-943	CLIP-seq
MIRT2554378	hsa-miR-1267	CLIP-seq
MIRT2430191	hsa-miR-3121-3p	CLIP-seq
MIRT2554386	hsa-miR-3143	CLIP-seq
MIRT2683103	hsa-miR-3168	CLIP-seq
MIRT2430194	hsa-miR-3673	CLIP-seq
MIRT2683104	hsa-miR-3920	CLIP-seq
MIRT1076558	hsa-miR-4422	CLIP-seq
MIRT2683105	hsa-miR-450b-5p	CLIP-seq
MIRT2683106	hsa-miR-4762-3p	CLIP-seq
MIRT2554406	hsa-miR-488	CLIP-seq
MIRT2438059	hsa-miR-495	CLIP-seq
MIRT2554412	hsa-miR-590-3p	CLIP-seq
MIRT2554413	hsa-miR-653	CLIP-seq
MIRT2554416	hsa-miR-943	CLIP-seq

Show/Hide all (12)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	15302918
GO:0001650	Component	Fibrillar center	IDA
GO:0003714	Function	Transcription corepressor activity	IDA	15302918
GO:0005515	Function	Protein binding	IPI	15302918, 32296183, 33961781, 35016035
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005829	Component	Cytosol	IDA
GO:0006629	Process	Lipid metabolic process	IEA
GO:0008270	Function	Zinc ion binding	IEA
GO:0017053	Component	Transcription repressor complex	IDA	15302918
GO:0046872	Function	Metal ion binding	IEA

MIM	HGNC	e!Ensembl
606246	28917	ENSG00000153814

Q86VZ6

Protein name

Juxtaposed with another zinc finger protein 1 (TAK1-interacting protein 27) (Zinc finger protein 802)

Protein function

Acts as a transcriptional corepressor of orphan nuclear receptor NR2C2 (PubMed:15302918). Inhibits expression of the gluconeogenesis enzyme PCK2 through inhibition of NR2C2 activity (By similarity). Also involved in transcriptional activation of

Family and domains

Tissue specificity

TISSUE SPECIFICITY: Highest expression in testis with moderate levels in colon, placenta, prostate and ovary and low levels in brain, spleen, liver and small intestine. {ECO:0000269|PubMed:15302918}.

Sequence

MTGIAAASFFSNTCRFGGCGLHFPTLADLIEHIEDNHIDTDPRVLEKQELQQPTYVALSY
INRFMTDAARREQESLKKKIQPKLSLTLSSSVSRGNVSTPPRHSSGSLTPPVTPPITPSS
SFRSSTPTGSEYDEEEVDYEESDSDESWTTESAISSEAILSSMCMNGGEEKPFACPVPGC
KKRYKNVNGIKYHAKNGHRTQIRVRKPFKCRCGKSYKTAQGLRHHTINFHPPVSAEIIRK
MQQ

Sequence length

243

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (62)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANKYLOSING SPONDYLITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTHMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATOPIC ASTHMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BASAL CELL CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHILDHOOD ONSET ASTHMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHN'S DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, NON-INSULIN-DEPENDENT	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, TYPE 2	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC EYE DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC NEPHROPATHY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC NEUROPATHY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC POLYNEUROPATHY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC RETINOPATHY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIVERTICULAR DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIAL NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIAL STROMAL SARCOMA	—	Orphanet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EOSINOPHILIC ESOPHAGITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESTROGEN-RECEPTOR NEGATIVE BREAST CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GOUT	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GRAVES DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG ADENOCARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUPUS ERYTHEMATOSUS, SYSTEMIC	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MALIGNANT EPITHELIAL TUMOR OF OVARY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOYAMOYA DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE SCLEROSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-ALCOHOLIC FATTY LIVER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OLIGOARTICULAR JUVENILE IDIOPATHIC ARTHRITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS, HIP	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS, KNEE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN ENDOMETRIOID CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN SEROUS CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PEPTIC ULCER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
POLYARTICULAR JUVENILE IDIOPATHIC ARTHRITIS, RHEUMATOID FACTOR NEGATIVE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RESPIRATORY SYSTEM DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCLEROSING CHOLANGITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCOLIOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SEASONAL ALLERGIC RHINITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SKIN CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SKIN NEOPLASM	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL LUNG CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC JUVENILE IDIOPATHIC ARTHRITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC LUPUS ERYTHEMATOSUS	—	GWAS catalog, Orphanet GWAS catalog, Orphanet GWAS catalog, Orphanet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC SCLERODERMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 1 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES NEPHROPATHY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ULCERATIVE COLITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (110)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Allergic rhinitis (disorder)	Allergic rhinitis	GWASCAT_DG	30013184		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	38511601	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ankylosing spondylitis	Ankylosing Spondylitis	GWASCAT_DG	26974007		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Arthritis Juvenile	Juvenile arthritis	Pubtator	30940621	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	29193869	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	31945409	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis, Gouty	Gouty arthritis	GWASCAT_DG	22179738		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	GWASCAT_DG	30929738, 31619474		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	Pubtator	31945409	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autoimmune Diseases	Autoimmune Diseases	BEFREE	23740937		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	33728753	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	24801046, 32856873, 33728753, 35649353	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood asthma	Asthma	GWASCAT_DG	30929738, 31036433		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangitis, Sclerosing	Cholangitis	GWASCAT_DG	26974007		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	24172857		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	21602532	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital chromosomal disease	Congenital Chromosomal Disease	BEFREE	21316079, 23959973		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	31177938		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	GWASDB_DG	21347282		★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	GWASCAT_DG	23128233, 26192919, 26974007		★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	GWASDB_DG	23128233		★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	26937622	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	19789630, 19998368, 24135527, 28603863, 29416651		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	18567820, 19998368, 36651297	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus	Diabetes Mellitus	BEFREE	19789630, 19998368, 24135527, 28603863, 29416651		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	35846288	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	18567820, 18694974, 18952825, 19020324, 19558691, 19592620, 20644627, 21602532, 22086326, 22113416, 22275441, 23193118, 24376643, 25785549, 27655316, 32948839, 33390804, 35846288 View all (3 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	GWASDB_DG	18372903, 20581827, 21647700, 22325160, 22885922, 23300278, 24509480		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	GWASCAT_DG	18372903, 20581827, 22885922, 24509480, 27189021, 28869590, 29358691, 30054458, 30595370, 31118516		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	CTD_human_DG	18372903		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	18567820, 18696045, 19020324, 19225753, 19455301, 19558691, 19670153, 20406958, 20927120, 21350842, 21602532, 22086326, 22113416, 22377712, 23193183 View all (7 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ECTRODACTYLY, ECTODERMAL DYSPLASIA, AND CLEFT LIP/PALATE SYNDROME 1	Ectrodactyly	BEFREE	26374646		★★★★★ ★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	GWASCAT_DG	30595370		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	18264096		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	CTD_human_DG	18264096		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial Neoplasms	CTD_human_DG	18264096		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Endometrial Stromal Sarcoma	Endometrial Stromal Sarcoma	BEFREE	16397222, 17235569, 18580489, 18722875, 19158498, 21316079, 21836477, 22456610, 22918161, 22982899, 23580382, 23599159, 23959973, 24186140, 24530230 View all (12 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Endometrial Stromal Sarcoma	Endometrial Stromal Sarcoma	ORPHANET_DG	25299308		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Endometrial stromal sarcoma	Endometrial Stromal Sarcoma	Orphanet			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Endometrial stromal sarcoma, high grade	Endometrial Stromal Sarcoma	BEFREE	25299308, 26444253, 28353387		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	28125717	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Eosinophilic esophagitis	Eosinophilia	BEFREE	29904099		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Eosinophilic esophagitis	Eosinophilia	GWASCAT_DG	29904099		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Eosinophilic Esophagitis	Eosinophilia	Pubtator	29904099	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Esophageal Neoplasms	Esophagus Neoplasm	GWASDB_DG	22960999		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	30154417		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	Pubtator	36639698	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gout	Gout	GWASCAT_DG	22179738		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Growth Disorders	Growth disorder	Pubtator	18952825	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoglycemia	Hypoglycemia	Pubtator	18952825	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	26937622		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	26937622, 40312552	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	33390804	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Juvenile pauciarticular chronic arthritis	Pauciarticular chronic arthritis	GWASCAT_DG	23603761		★★★★★ ★☆☆☆☆ Found in Text Mining only
Juvenile-Onset Still Disease	Still Disease	GWASCAT_DG	23603761		★★★★★ ★☆☆☆☆ Found in Text Mining only
Libman-Sacks Disease	Nonbacterial verrucal endocardiosis	CTD_human_DG	19838195		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liposarcoma, Dedifferentiated	liposarcoma	BEFREE	26444253		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	26337813		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	19838195, 20406958, 34952359, 40312552	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	19838195, 20406958, 23740937		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Erythematosus, Systemic	Lupus Erythematosus	GWASCAT_DG	19838195, 23740937, 26502338, 28714469		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Erythematosus, Systemic	Lupus Erythematosus	CTD_human_DG	19838195		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Erythematosus, Systemic	Lupus Erythematosus	ORPHANET_DG	19838195		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	18264096		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	18264096, 18696045, 19558691, 19998368, 20406958, 23193118, 24801046, 29416651		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CTD_human_DG	18264096		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	31357957		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	19158498, 19998368, 20406958		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	24172857		★★★★★ ★☆☆☆☆ Found in Text Mining only
Moyamoya Disease	Moyamoya Disease	GWASCAT_DG	29273593		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Moyamoya disease 1	Moyamoya disease	GWASCAT_DG	29273593		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	GWASDB_DG	22190364		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis	Multiple Sclerosis	GWASCAT_DG	24076602		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis	Multiple sclerosis	Pubtator	31945409	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Ischemia	Myocardial Ischemia	BEFREE	31177938		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	16049311, 17197920, 18077430, 21316079, 22918161, 23629446, 23959973, 25133706, 26444253, 28353387, 29394168, 30028354		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nodular Goiter	Nodular Goiter	BEFREE	31819531		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	30154417		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	Pubtator	18567820, 32948839, 37800791	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Oligoarticular Juvenile Idiopathic Arthritis	Oligoarticular Arthritis	GWASCAT_DG	23603761		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteoarthritis	Osteoarthritis	Pubtator	31945409	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteoporosis	Osteoporosis	Pubtator	37831088	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	GWASCAT_DG	30898391		★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	31819531		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polyarticular Juvenile Idiopathic Arthritis, Rheumatoid Factor Negative	Seronegative polyarthritis	GWASCAT_DG	23603761		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostate carcinoma	Prostate cancer	BEFREE	18264096, 18696045, 19558691, 19998368, 20406958, 23193118, 24801046, 29416651		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostate carcinoma	Prostate cancer	GWASCAT_DG	26034056, 29892016		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	CTD_human_DG	18264096		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	18952825, 19318432, 19558691, 19998368, 20406958, 20460480, 21071540, 21538423, 22086326, 23193118, 24411283, 24497837, 24801046, 25274378, 36166196	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psoriasis	Psoriasis	GWASCAT_DG	26974007		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psoriasis	Psoriasis	BEFREE	28603863		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Respiratory Tract Diseases	Respiratory Tract Diseases	GWASCAT_DG	30595370		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	GWASCAT_DG	24390342		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rheumatoid Arthritis	Rheumatoid arthritis	GWASDB_DG	24390342		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rheumatoid Arthritis, Systemic Juvenile	Rheumatoid arthritis	GWASCAT_DG	23603761		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	22456610, 22918161, 27154512, 28863072		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	Pubtator	34561551	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma Endometrial Stromal	Endometrial stromal sarcoma	Pubtator	22918161, 22982899, 26429873, 28758277, 31281901, 31615558, 32385140, 34561551, 34651371, 34928964, 35649353, 35710139, 36731460, 37406360	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	30154417		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	31357957		★★★★★ ★☆☆☆☆ Found in Text Mining only
Systemic lupus erythematosus	Systemic lupus erythematosus	Orphanet			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Systemic onset juvenile chronic arthritis	Arthritis	GWASCAT_DG	23603761		★★★★★ ★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	23740937		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Systemic Scleroderma	Scleroderma	GWASDB_DG	23740937		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Systemic Scleroderma	Scleroderma	GWASCAT_DG	23740937		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thalassemia	Thalassemia	Pubtator	35322124	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	32856873	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	GWASCAT_DG	26974007		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	37800791	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Neoplasms	Uterine neoplasm	Pubtator	31615558	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

JAZF1 (JAZF zinc finger 1)