ZSCAN25 (zinc finger and SCAN domain containing 25)

Gene Gene information from NCBI Gene database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID 221785
Gene name Zinc finger and SCAN domain containing 25
Gene symbol ZSCAN25
Synonyms (NCBI Gene)
ZNF498
Chromosome 7
Chromosome location 7q22.1
Summary This gene encodes a protein that bears some similarity to zinc finger proteins, which are involved in DNA binding and protein-protein interactions. Multiple alternatively spliced transcript variants have been identified, but the full-length nature for mos
miRNA miRNA information provided by mirtarbase database.
211
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (211)
miRTarBase ID miRNA Experiments Reference
MIRT042207 hsa-miR-484 CLASH 23622248
MIRT709434 hsa-miR-4656 HITS-CLIP 19536157
MIRT709433 hsa-miR-6829-5p HITS-CLIP 19536157
MIRT709432 hsa-miR-4492 HITS-CLIP 19536157
MIRT709431 hsa-miR-4498 HITS-CLIP 19536157
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
10
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (10)
GO ID Ontology Definition Evidence Reference
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA
GO:0003677 Function DNA binding IEA
GO:0005515 Function Protein binding IPI 32296183
GO:0005634 Component Nucleus IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein Protein information from UniProt database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q6NSZ9
Protein name Zinc finger and SCAN domain-containing protein 25 (Zinc finger protein 498)
Protein function May be involved in transcriptional regulation.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF02023 SCAN 38 → 127 SCAN domain Domain
PF00096 zf-C2H2 348 → 370 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 375 → 397 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 403 → 425 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 431 → 453 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 459 → 480 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 486 → 508 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 514 → 537 Zinc finger, C2H2 type Domain
Sequence 
MLKEHPEMAEAPQQQLGIPVVKLEKELPWGRGREDPSPETFRLRFRQFRYQEAAGPQEAL
RELQELCRRWLRPELHTKEQILELLVLEQFLTILPREFYAWIREHGPESGKALAAMVEDL
TERALEAKAVPCHRQGEQEETALCRGAWEPGIQLGPVEVKPEWGMPPGEGVQGPDPGTEE
QLSQDPGDETRAFQEQALPVLQAGPGLPAVNPRDQEMAAGFFTAGSQGLGPFKDMALAFP
EEEWRHVTPAQIDCFGEYVEPQDCRVSPGGGSKEKEAKPPQEDLKGALVALTSERFGEAS
LQGPGLGRVCEQEPGGPAGSAPGLPPPQHGAIPLPDEVKTHSSFWKPFQCPECGKGFSRS
SNLVRHQRTHEEKSYGCVECGKGFTLREYLMKHQRTHLGKRPYVCSECWKTFSQRHHLEV
HQRSHTGEKPYKCGDCWKSFSRRQHLQVHRRTHTGEKPYTCECGKSFSRNANLAVHRRAH
TGEKPYGCQVCGKRFSKGERLVRHQRIHTGEKPYHCPACGRSFNQRSILNRHQKTQHRQE
PLVQ
Sequence length 544
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
  Reactome
    Generic Transcription Pathway
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
1
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Show/Hide Unknown Diseases (1)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
HYPERTENSION, SALT-SENSITIVE ESSENTIAL, SUSCEPTIBILITY TO — Disgenet
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Show/Hide Text Mining Associations (6)
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Alagille Syndrome Alagille syndrome Pubtator 38166538 Associate
★★★★★
★☆☆☆☆
Found in Text Mining only
Epilepsy Epilepsy BEFREE 31564953
★★★★★
★☆☆☆☆
Found in Text Mining only
Lung Neoplasms Lung neoplasms Pubtator 32350633 Associate
★★★★★
★☆☆☆☆
Found in Text Mining only
Mucocutaneous Lymph Node Syndrome Kawasaki disease GWASDB_DG 23677057
★★★★★
★☆☆☆☆
Found in Text Mining only
Ovarian Neoplasms Ovarian neoplasm Pubtator 31578411 Associate
★★★★★
★☆☆☆☆
Found in Text Mining only
Seizures Seizures Pubtator 38166538 Associate
★★★★★
★☆☆☆☆
Found in Text Mining only