FCGRT (Fc gamma receptor and transporter)

Gene

• Entrez ID: 2217
• Gene name: Fc gamma receptor and transporter
• Gene symbol: FCGRT
• Synonyms (NCBI Gene): FCRN, FcgammaRn, alpha-chain
• Chromosome: 19
• Chromosome location: 19q13.33
• Summary: This gene encodes a receptor that binds the Fc region of monomeric immunoglobulin G. The encoded protein transfers immunoglobulin G antibodies from mother to fetus across the placenta. This protein also binds immunoglobulin G to protect the antibody from

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT017375	hsa-miR-335-5p	Microarray	18185580
MIRT2428853	hsa-miR-146a	CLIP-seq
MIRT2428854	hsa-miR-146b-5p	CLIP-seq
MIRT2428855	hsa-miR-3136-3p	CLIP-seq
MIRT2428856	hsa-miR-3181	CLIP-seq
MIRT2428857	hsa-miR-3944-3p	CLIP-seq
MIRT2428858	hsa-miR-4750	CLIP-seq
MIRT2428859	hsa-miR-589	CLIP-seq
MIRT2428860	hsa-miR-603	CLIP-seq
MIRT2532399	hsa-miR-1237	CLIP-seq
MIRT2532400	hsa-miR-1299	CLIP-seq
MIRT2532401	hsa-miR-1321	CLIP-seq
MIRT2532402	hsa-miR-140-3p	CLIP-seq
MIRT2532403	hsa-miR-181a	CLIP-seq
MIRT2532404	hsa-miR-181b	CLIP-seq
MIRT2532405	hsa-miR-181c	CLIP-seq
MIRT2532406	hsa-miR-181d	CLIP-seq
MIRT2532407	hsa-miR-1827	CLIP-seq
MIRT2532408	hsa-miR-199a-5p	CLIP-seq
MIRT2532409	hsa-miR-199b-5p	CLIP-seq
MIRT2532410	hsa-miR-24	CLIP-seq
MIRT2532411	hsa-miR-2467-5p	CLIP-seq
MIRT2532412	hsa-miR-2861	CLIP-seq
MIRT2532413	hsa-miR-3127-3p	CLIP-seq
MIRT2532414	hsa-miR-342-3p	CLIP-seq
MIRT2532415	hsa-miR-3612	CLIP-seq
MIRT2532416	hsa-miR-3919	CLIP-seq
MIRT2532417	hsa-miR-4255	CLIP-seq
MIRT2532418	hsa-miR-4262	CLIP-seq
MIRT2532419	hsa-miR-4283	CLIP-seq
MIRT2532420	hsa-miR-4315	CLIP-seq
MIRT2532421	hsa-miR-4419a	CLIP-seq
MIRT2532422	hsa-miR-4443	CLIP-seq
MIRT2532423	hsa-miR-4459	CLIP-seq
MIRT2532424	hsa-miR-4508	CLIP-seq
MIRT2532425	hsa-miR-4510	CLIP-seq
MIRT2532426	hsa-miR-4700-3p	CLIP-seq
MIRT2532427	hsa-miR-4708-5p	CLIP-seq
MIRT2532428	hsa-miR-4739	CLIP-seq
MIRT2532429	hsa-miR-4747-3p	CLIP-seq
MIRT2532430	hsa-miR-4756-3p	CLIP-seq
MIRT2532431	hsa-miR-4756-5p	CLIP-seq
MIRT2532432	hsa-miR-4782-5p	CLIP-seq
MIRT2532433	hsa-miR-4790-5p	CLIP-seq
MIRT2532434	hsa-miR-488	CLIP-seq
MIRT2532435	hsa-miR-516b	CLIP-seq
MIRT2532436	hsa-miR-520a-5p	CLIP-seq
MIRT2532437	hsa-miR-525-5p	CLIP-seq
MIRT2532438	hsa-miR-549	CLIP-seq
MIRT2532439	hsa-miR-650	CLIP-seq
MIRT2532440	hsa-miR-665	CLIP-seq
MIRT2532399	hsa-miR-1237	CLIP-seq
MIRT2532400	hsa-miR-1299	CLIP-seq
MIRT2532401	hsa-miR-1321	CLIP-seq
MIRT2532402	hsa-miR-140-3p	CLIP-seq
MIRT2532403	hsa-miR-181a	CLIP-seq
MIRT2532404	hsa-miR-181b	CLIP-seq
MIRT2532405	hsa-miR-181c	CLIP-seq
MIRT2532406	hsa-miR-181d	CLIP-seq
MIRT2532407	hsa-miR-1827	CLIP-seq
MIRT2532408	hsa-miR-199a-5p	CLIP-seq
MIRT2532409	hsa-miR-199b-5p	CLIP-seq
MIRT2532410	hsa-miR-24	CLIP-seq
MIRT2532411	hsa-miR-2467-5p	CLIP-seq
MIRT2532412	hsa-miR-2861	CLIP-seq
MIRT2532413	hsa-miR-3127-3p	CLIP-seq
MIRT2532414	hsa-miR-342-3p	CLIP-seq
MIRT2532415	hsa-miR-3612	CLIP-seq
MIRT2532416	hsa-miR-3919	CLIP-seq
MIRT2532417	hsa-miR-4255	CLIP-seq
MIRT2532418	hsa-miR-4262	CLIP-seq
MIRT2532419	hsa-miR-4283	CLIP-seq
MIRT2532421	hsa-miR-4419a	CLIP-seq
MIRT2532422	hsa-miR-4443	CLIP-seq
MIRT2532423	hsa-miR-4459	CLIP-seq
MIRT2532424	hsa-miR-4508	CLIP-seq
MIRT2532425	hsa-miR-4510	CLIP-seq
MIRT2532426	hsa-miR-4700-3p	CLIP-seq
MIRT2532427	hsa-miR-4708-5p	CLIP-seq
MIRT2532428	hsa-miR-4739	CLIP-seq
MIRT2532429	hsa-miR-4747-3p	CLIP-seq
MIRT2532430	hsa-miR-4756-3p	CLIP-seq
MIRT2532431	hsa-miR-4756-5p	CLIP-seq
MIRT2532432	hsa-miR-4782-5p	CLIP-seq
MIRT2532434	hsa-miR-488	CLIP-seq
MIRT2532435	hsa-miR-516b	CLIP-seq
MIRT2532436	hsa-miR-520a-5p	CLIP-seq
MIRT2532437	hsa-miR-525-5p	CLIP-seq
MIRT2532438	hsa-miR-549	CLIP-seq
MIRT2532439	hsa-miR-650	CLIP-seq
MIRT2532440	hsa-miR-665	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
STAT1	Repression	18566411

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002416	Process	IgG immunoglobulin transcytosis in epithelial cells mediated by FcRn immunoglobulin receptor	NAS	7964511
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005615	Component	Extracellular space	IBA
GO:0005768	Component	Endosome	IEA
GO:0005886	Component	Plasma membrane	IEA
GO:0006955	Process	Immune response	IBA
GO:0009897	Component	External side of plasma membrane	IBA
GO:0010008	Component	Endosome membrane	IEA
GO:0016020	Component	Membrane	IEA
GO:0019864	Function	IgG binding	IDA	7964511
GO:0019864	Function	IgG binding	IEA
GO:0030881	Function	Beta-2-microglobulin binding	IBA
GO:0030881	Function	Beta-2-microglobulin binding	IEA
GO:0042605	Function	Peptide antigen binding	ISS

Other IDs

• MIM: 601437
• HGNC: 3621
• e!Ensembl: ENSG00000104870

Protein

• UniProt ID: P55899
• Protein name: IgG receptor FcRn large subunit p51 (FcRn) (IgG Fc fragment receptor transporter alpha chain) (Neonatal Fc receptor)
• Protein function: Cell surface receptor that transfers passive humoral immunity from the mother to the newborn. Binds to the Fc region of monomeric immunoglobulin gamma and mediates its selective uptake from milk (PubMed:10933786, PubMed:7964511). IgG in the milk
• PDB: 1EXU, 3M17, 3M1B, 4K71, 4N0F, 4N0U, 5BJT, 5BXF, 5WHK, 6C97, 6C98, 6C99, 6FGB, 6ILM, 6LA6, 6LA7, 6NHA, 6QIO, 6QIP, 6WNA, 6WOL, 7B5F, 7C9V, 7Q15, 7XXA, 9MI6
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00129	MHC_I	26 → 197	Class I Histocompatibility antigen, domains alpha 1 and 2	Domain
  PF07654	C1-set	207 → 282	Immunoglobulin C1-set domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed in full-term placenta, heart, lung, liver, muscle, kidney, pancreas, and both fetal and adult small intestine. {ECO:0000269|PubMed:28330995, ECO:0000269|PubMed:7964511}.
• Sequence:

  MGVPRPQPWALGLLLFLLPGSLGAESHLSLLYHLTAVSSPAPGTPAFWVSGWLGPQQYLS
  YNSLRGEAEPCGAWVWENQVSWYWEKETTDLRIKEKLFLEAFKALGGKGPYTLQGLLGCE
  LGPDNTSVPTAKFALNGEEFMNFDLKQGTWGGDWPEALAISQRWQQQDKAANKELTFLLF
  SCPHRLREHLERGRGNLEWKEPPSMRLKARPSSPGFSVLTCSAFSFYPPELQLRFLRNGL
  AAGTGQGDFGPNSDGSFHASSSLTVKSGDEHHYCCIVQHAGLAQPLRVELESPAKSSVLV
  VGIVIGVLLLTAAAVGGALLWRRMRSGLPAPWISLRGDDTGVLLPTPGEAQDADLKDVNV
  IPATA

• Sequence length: 365

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
NON-MELANOMA SKIN CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acquired Hypogammaglobulinemia	Common Variable Immunodeficiency	BEFREE	23286945		★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	3500187		★☆☆☆☆ Found in Text Mining only
Acute monocytic leukemia	Monocytic Leukemia	BEFREE	1387692		★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	3500187		★☆☆☆☆ Found in Text Mining only
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	BEFREE	1984842, 2895757		★☆☆☆☆ Found in Text Mining only
Afibrinogenemia	Afibrinogenemia	BEFREE	17179831, 18388508		★☆☆☆☆ Found in Text Mining only
alpha^+^ Thalassemia	alpha Thalassemia	BEFREE	747178		★☆☆☆☆ Found in Text Mining only
Alport Syndrome	Alport Syndrome	BEFREE	11423936		★☆☆☆☆ Found in Text Mining only
Amyloid nephropathy	Amyloid Nephropathy	BEFREE	19073821, 8639778		★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	8113408, 8639778		★☆☆☆☆ Found in Text Mining only
Angioimmunoblastic Lymphadenopathy	Angioimmunoblastic T-cell lymphoma	BEFREE	2293883		★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	30653981		★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm	Aortic Aneurysm	BEFREE	1391954		★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	BEFREE	1391954		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	21690327		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	12070183, 16757160		★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia Telangiectasia	BEFREE	3422210		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	19772792, 24404896, 26260795, 27019051, 29093180, 29572538, 30130439		★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	2535034		★☆☆☆☆ Found in Text Mining only
beta^0^ Thalassemia	beta Thalassemia	BEFREE	747178		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	14680494	Associate	★☆☆☆☆ Found in Text Mining only
Bronchiectasis	Bronchiectasis	BEFREE	20627700		★☆☆☆☆ Found in Text Mining only
Carcinoma in Situ	Carcinoma in situ	Pubtator	14680494	Associate	★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	BEFREE	3805283		★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	3500187		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	27384673		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	24290911, 29735609		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	27384673	Associate	★☆☆☆☆ Found in Text Mining only
Common Variable Immunodeficiency	Common Variable Immunodeficiency	BEFREE	20627700, 23286945		★☆☆☆☆ Found in Text Mining only
Congenital hypofibrinogenemia	Congenital afibrinogenemia	BEFREE	11739173		★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	BEFREE	11678851		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	27469170		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	27469170		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	25918233, 3805283		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	29949391		★☆☆☆☆ Found in Text Mining only
Diabetes, Autoimmune	Autoimmune Diabetes	BEFREE	25918233		★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down syndrome	Pubtator	34040082	Associate	★☆☆☆☆ Found in Text Mining only
Ewings sarcoma	Ewing sarcoma	BEFREE	25025207		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	3027177		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	3027177		★☆☆☆☆ Found in Text Mining only
GM2-GANGLIOSIDOSIS, LATE ONSET	Gangliosidosis	BEFREE	8757036		★☆☆☆☆ Found in Text Mining only
Gm2-Gangliosidosis, Variant B1	Gangliosidosis	BEFREE	2137287, 2973311		★☆☆☆☆ Found in Text Mining only
Hallopeau-Siemens Disease	DYSTROPHIC EPIDERMOLYSIS BULLOSA	BEFREE	29653141		★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto Disease	BEFREE	28081504, 29908223		★☆☆☆☆ Found in Text Mining only
Hemophilia B	Hemophilia	BEFREE	29523681		★☆☆☆☆ Found in Text Mining only
Henoch-Schoenlein Purpura	Henoch-Schonlein Nephritis	BEFREE	1400899		★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	36309388	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary nephritis	Hereditary Nephritis	BEFREE	11423936		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	1532439		★☆☆☆☆ Found in Text Mining only
Hyperthyroidism	Hyperthyroidism	BEFREE	2453529		★☆☆☆☆ Found in Text Mining only
IGA Glomerulonephritis	Glomerulonephritis	BEFREE	10430975, 9261038		★☆☆☆☆ Found in Text Mining only
Immune thrombocytopenic purpura	Immune Thrombocytopenic Purpura	BEFREE	20647570, 22001393, 30529500, 31821591		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	27481307		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	31553647, 3494806		★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	3122210		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	1387692		★☆☆☆☆ Found in Text Mining only
Leukemia, T-Cell	T-cell leukemia	BEFREE	1984842, 2895757, 3919442		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	27769251		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	27384673	Inhibit	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	7706484		★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus Nephritis	BEFREE	19772792		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	36309388	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	3919442		★☆☆☆☆ Found in Text Mining only
Lymphomatoid Papulosis	Lymphomatoid Papulosis	BEFREE	1532439		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	25517305, 8418381		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	27384673		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	31449666		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	10871789, 12825072, 1348852, 1387654		★☆☆☆☆ Found in Text Mining only
Myotonic Dystrophy	Myotonic dystrophy	Pubtator	27469170	Inhibit	★☆☆☆☆ Found in Text Mining only
Necrotizing Enterocolitis	Necrotizing Enterocolitis	BEFREE	14523823		★☆☆☆☆ Found in Text Mining only
Necrotizing enterocolitis in fetus OR newborn	Necrotizing Enterocolitis	BEFREE	14523823		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	2116665, 27384673, 30323819, 3872924		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	27384673		★☆☆☆☆ Found in Text Mining only
Papilloma	Papilloma	BEFREE	29743371		★☆☆☆☆ Found in Text Mining only
Pemphigus	Pemphigus	Pubtator	30116249	Associate	★☆☆☆☆ Found in Text Mining only
Pemphigus Vulgaris	Pemphigus Vulgaris	BEFREE	26260795		★☆☆☆☆ Found in Text Mining only
Precursor B-cell lymphoblastic leukemia	Lymphoblastic Leukemia	BEFREE	3500187		★☆☆☆☆ Found in Text Mining only
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	3500187		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	36243890	Associate	★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	BEFREE	25025207		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	25823782		★☆☆☆☆ Found in Text Mining only
Sarcoma Ewing	Sarcoma	Pubtator	25025207	Associate	★☆☆☆☆ Found in Text Mining only
Skin carcinoma	Skin Carcinoma	BEFREE	29743371		★☆☆☆☆ Found in Text Mining only
Tay-Sachs Disease	Tay-Sachs Disease	BEFREE	2356966, 2824459, 3375249, 7827134		★☆☆☆☆ Found in Text Mining only