RNF182 (ring finger protein 182)

Gene

• Entrez ID: 221687
• Gene name: Ring finger protein 182
• Gene symbol: RNF182
• Synonyms (NCBI Gene): -
• Chromosome: 6
• Chromosome location: 6p23

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT022017	hsa-miR-128-3p	Sequencing	20371350
MIRT028709	hsa-miR-27a-3p	Sequencing	20371350
MIRT048330	hsa-miR-106a-5p	CLASH	23622248
MIRT1311502	hsa-miR-1264	CLIP-seq
MIRT1311503	hsa-miR-371-5p	CLIP-seq
MIRT1311504	hsa-miR-377	CLIP-seq
MIRT1311505	hsa-miR-431	CLIP-seq
MIRT1311506	hsa-miR-888	CLIP-seq
MIRT1311507	hsa-miR-4299	CLIP-seq
MIRT1311508	hsa-miR-4456	CLIP-seq
MIRT1311509	hsa-miR-4709-3p	CLIP-seq
MIRT1311510	hsa-miR-485-3p	CLIP-seq
MIRT1311511	hsa-miR-520d-5p	CLIP-seq
MIRT1311512	hsa-miR-524-5p	CLIP-seq
MIRT1311513	hsa-miR-548q	CLIP-seq
MIRT2092524	hsa-miR-136	CLIP-seq
MIRT2092525	hsa-miR-3158-3p	CLIP-seq
MIRT2092526	hsa-miR-4330	CLIP-seq
MIRT2092527	hsa-miR-4432	CLIP-seq
MIRT2092528	hsa-miR-4499	CLIP-seq
MIRT2092529	hsa-miR-4659a-3p	CLIP-seq
MIRT2092530	hsa-miR-4659b-3p	CLIP-seq
MIRT2092531	hsa-miR-499-5p	CLIP-seq
MIRT2092532	hsa-miR-942	CLIP-seq
MIRT2458431	hsa-miR-3065-5p	CLIP-seq
MIRT1311504	hsa-miR-377	CLIP-seq
MIRT2689846	hsa-miR-1183	CLIP-seq
MIRT2689847	hsa-miR-1208	CLIP-seq
MIRT2689848	hsa-miR-3064-3p	CLIP-seq
MIRT2689849	hsa-miR-34c-3p	CLIP-seq
MIRT2689850	hsa-miR-3919	CLIP-seq
MIRT2689851	hsa-miR-4528	CLIP-seq
MIRT2092529	hsa-miR-4659a-3p	CLIP-seq
MIRT2092530	hsa-miR-4659b-3p	CLIP-seq
MIRT2689852	hsa-miR-4731-3p	CLIP-seq
MIRT2689853	hsa-miR-4778-3p	CLIP-seq
MIRT2689854	hsa-miR-4789-5p	CLIP-seq
MIRT2689855	hsa-miR-4797-5p	CLIP-seq
MIRT2689856	hsa-miR-4801	CLIP-seq
MIRT2689857	hsa-miR-548p	CLIP-seq
MIRT2689858	hsa-miR-602	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004842	Function	Ubiquitin-protein transferase activity	IBA
GO:0004842	Function	Ubiquitin-protein transferase activity	IDA	18298843
GO:0005515	Function	Protein binding	IPI	18298843, 19690564, 25260751, 32296183
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	18298843
GO:0005737	Component	Cytoplasm	IEA
GO:0008270	Function	Zinc ion binding	IEA
GO:0016020	Component	Membrane	IEA
GO:0016567	Process	Protein ubiquitination	IBA
GO:0016567	Process	Protein ubiquitination	IDA	18298843
GO:0016567	Process	Protein ubiquitination	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0061630	Function	Ubiquitin protein ligase activity	IEA

Other IDs

• MIM: 621026
• HGNC: 28522
• e!Ensembl: ENSG00000180537

Protein

• UniProt ID: Q8N6D2
• Protein name: E3 ubiquitin-protein ligase RNF182 (EC 2.3.2.27) (RING finger protein 182) (RING-type E3 ubiquitin transferase RNF182)
• Protein function: E3 ubiquitin-protein ligase that mediates the ubiquitination of ATP6V0C and targets it to degradation via the ubiquitin-proteasome pathway (PubMed:18298843). Also plays a role in the inhibition of TLR-triggered innate immune response by mediatin
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF13639	zf-RING_2	18 → 68	Ring finger domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Up-regulated in neuronal cells subjected to cell death-inducing injuries, such as oxygen and glucose deprivation (at protein level). Could be up-regulated in Alzheimer disease brains (PubMed:18298843). Highly expressed in innate immune
• Sequence:

  MASQPPEDTAESQASDELECKICYNRYNLKQRKPKVLECCHRVCAKCLYKIIDFGDSPQG
  VIVCPFCRFETCLPDDEVSSLPDDNNILVNLTCGGKGKKCLPENPTELLLTPKRLASLVS
  PSHTSSNCLVITIMEVQRESSPSLSSTPVVEFYRPASFDSVTTVSHNWTVWNCTSLLFQT
  SIRVLVWLLGLLYFSSLPLGIYLLVSKKVTLGVVFVSLVPSSLVILMVYGFCQCVCHEFL
  DCMAPPS

• Sequence length: 247

Pathways

Reactome:

Antigen processing: Ubiquitination & Proteasome degradation

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
BREAST CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY STENOSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC LUPUS ERYTHEMATOSUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	30450663		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	CTD_human_DG	18507500		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Carcinoma	Colorectal Cancer	CTD_human_DG	18507500		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	UNIPROT_DG			★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	CTD_human_DG	18507500		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	37783761	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	CTD_human_DG	18507500		★☆☆☆☆ Found in Text Mining only
Mammary Carcinoma, Human	Marfan Syndrome	CTD_human_DG	18507500		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	CTD_human_DG	18507500		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms, Human	Mammary Neoplasms	CTD_human_DG	18507500		★☆☆☆☆ Found in Text Mining only