ZBTB12 (zinc finger and BTB domain containing 12)

Gene

• Entrez ID: 221527
• Gene name: Zinc finger and BTB domain containing 12
• Gene symbol: ZBTB12
• Synonyms (NCBI Gene): Bat9, C6orf46, D6S59E, G10, NG35
• Chromosome: 6
• Chromosome location: 6p21.33

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT651406	hsa-miR-7110-3p	HITS-CLIP	23824327
MIRT651407	hsa-miR-204-3p	HITS-CLIP	23824327
MIRT651404	hsa-miR-4646-5p	HITS-CLIP	23824327
MIRT651405	hsa-miR-627-3p	HITS-CLIP	23824327
MIRT651403	hsa-miR-4314	HITS-CLIP	23824327
MIRT651406	hsa-miR-7110-3p	HITS-CLIP	23824327
MIRT651407	hsa-miR-204-3p	HITS-CLIP	23824327
MIRT651404	hsa-miR-4646-5p	HITS-CLIP	23824327
MIRT651405	hsa-miR-627-3p	HITS-CLIP	23824327
MIRT651403	hsa-miR-4314	HITS-CLIP	23824327
MIRT2371557	hsa-miR-3176	CLIP-seq
MIRT2371558	hsa-miR-331-3p	CLIP-seq
MIRT2371559	hsa-miR-3922-3p	CLIP-seq
MIRT2371560	hsa-miR-3938	CLIP-seq
MIRT2371561	hsa-miR-4757-5p	CLIP-seq
MIRT2371562	hsa-miR-548b-3p	CLIP-seq
MIRT2397181	hsa-miR-4446-5p	CLIP-seq
MIRT2664801	hsa-miR-4267	CLIP-seq
MIRT2664802	hsa-miR-4325	CLIP-seq
MIRT2664803	hsa-miR-4639-3p	CLIP-seq
MIRT2664804	hsa-miR-513c	CLIP-seq
MIRT2664805	hsa-miR-514b-5p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IBA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	IBA
GO:0001817	Process	Regulation of cytokine production	IBA
GO:0002682	Process	Regulation of immune system process	IBA
GO:0003677	Function	DNA binding	IEA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IBA
GO:0005654	Component	Nucleoplasm	IDA
GO:0008270	Function	Zinc ion binding	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536

Other IDs

• MIM: HGNC
• HGNC: N/A
• e!Ensembl: HGNC

Protein

• UniProt ID: Q9Y330
• Protein name: Zinc finger and BTB domain-containing protein 12 (Protein G10)
• Protein function: May be involved in transcriptional regulation.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00651	BTB	23 → 127	BTB/POZ domain	Domain
  PF00096	zf-C2H2	359 → 381	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	387 → 409	Zinc finger, C2H2 type	Domain

• Sequence:

  MASGVEVLRFQLPGHEAATLRNMNQLRAEERFCDVTIVADSLKFRGHKVILAACSPFLRD
  QFLLNPSSELQVSLMHSARIVADLLLSCYTGALEFAVRDIVNYLTAASYLQMEHVVEKCR
  NALSQFIEPKIGLKEDGVSEASLVSSISATKSLLPPARTPKPAPKPPPPPPLPPPLLRPV
  KLEFPLDEDLELKAEEEDEDEDEDVSDICIVKVESALEVAHRLKPPGGLGGGLGIGGSVG
  GHLGELAQSSVPPSTVAPPQGVVKACYSLSEDAEGEGLLLIPGGRASVGATSGLVEAAAV
  AMAARGAGGSLGAGGSRGPLPGGFSGGNPLKNIKCTKCPEVFQGVEKLVFHMRAQHFIFM
  CPRCGKQFNHSSNLNRHMNVHRGVKSHSCGICGKCFTQKSTLHDHLNLHSGARPYRCSYC
  DVRFAHKPAIRRHLKEQHGKTTAENVLEASVAEINVLIR

• Sequence length: 459

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
NON-MELANOMA SKIN CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Blood Coagulation Disorders	Blood coagulation disorder	Pubtator	31077224	Associate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	23079975	Associate	★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	31077224		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	31077224	Associate	★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	31077224		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	31077224	Associate	★☆☆☆☆ Found in Text Mining only
Oestrogen receptor positive breast cancer	Oestrogen Receptor Positive Breast Cancer	BEFREE	23079975		★☆☆☆☆ Found in Text Mining only
Stomach Diseases	Stomach disease	Pubtator	37708965	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	37708965	Associate	★☆☆☆☆ Found in Text Mining only